Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4687
Gene name
LocationContig_40:1572..1858
Strand-
Gene length (bp)286
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99974

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5434
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4687 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3198
Ophiocordyceps camponoti-floridani Ophcf2|00974
Ophiocordyceps camponoti-rufipedis Ophun1|1331
Ophiocordyceps kimflemingae Ophio5|2017
Ophiocordyceps subramaniannii Hirsu2|5965

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4687
MKFTLALIASLASVALATPGYSGCKPGTYQCATKNGKQGWEVCDTSRNWEWGGYCEHGTSCWFDWQNGSPYCK*
Coding >OphauG2|4687
ATGAAGTTCACTCTTGCCCTCATCGCTTCTCTTGCCTCTGTGGCCCTTGCCACTCCTGGCTACTCGGGCTGCAAG
CCTGGCACGTATCAGTGCGCGACCAAGAATGGAAAGCAGGGCTGGGAAGTCTGTGACACGAGCCGCAACTGGGAG
TGGGGTGGCTACTGCGAGCACGGCACGTCGTGCTGGTTCGACTGGCAGAACGGCAGCCCTTACTGCAAGTAA
Transcript >OphauG2|4687
ATGAAGTTCACTCTTGCCCTCATCGCTTCTCTTGCCTCTGTGGCCCTTGCCACTCCTGGCTACTCGGGCTGCAAG
CCTGGCACGTATCAGTGCGCGACCAAGAATGGAAAGCAGGGCTGGGAAGTCTGTGACACGAGCCGCAACTGGGAG
TGGGGTGGCTACTGCGAGCACGGCACGTCGTGCTGGTTCGACTGGCAGAACGGCAGCCCTTACTGCAAGTAA
Gene >OphauG2|4687
ATGAAGTTCACTCTTGCCCTCATCGCTTCTCTTGCCTCTGTGGCCCTTGCCACTCCTGGCTACTCGGGCTGCAAG
CCTGGCACGTATCAGTGCGCGACCAAGAATGGAAAGCAGGGCTGGGAAGTCTGTGACACGAGCCGCAACTGGGAG
GTAAGTGTTTACAAAGACGCTGCATCGTGACAACAACCGAGTTCTGACGCGAGACTTTGAACAGTGGGGTGGCTA
CTGCGAGCACGGCACGTCGTGCTGGTTCGACTGGCAGAACGGCAGCCCTTACTGCAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail