Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4681
Gene name
LocationContig_4:63403..64254
Strand-
Gene length (bp)851
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10232 Med8 Mediator of RNA polymerase II transcription complex subunit 8 2.1E-39 7 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SGQ0|MED8_NEUCR Mediator of RNA polymerase II transcription subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-8 PE=3 SV=1 3 221 5.0E-37
sp|Q2HDD6|MED8_CHAGB Mediator of RNA polymerase II transcription subunit 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MED8 PE=3 SV=1 6 173 2.0E-34
sp|Q1DLG1|MED8_COCIM Mediator of RNA polymerase II transcription subunit 8 OS=Coccidioides immitis (strain RS) GN=MED8 PE=3 SV=1 6 173 8.0E-31
sp|Q2UGT1|MED8_ASPOR Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med8 PE=3 SV=1 8 173 1.0E-27
sp|A1CXD6|MED8_NEOFI Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=med8 PE=3 SV=1 6 173 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SGQ0|MED8_NEUCR Mediator of RNA polymerase II transcription subunit 8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=med-8 PE=3 SV=1 3 221 5.0E-37
sp|Q2HDD6|MED8_CHAGB Mediator of RNA polymerase II transcription subunit 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MED8 PE=3 SV=1 6 173 2.0E-34
sp|Q1DLG1|MED8_COCIM Mediator of RNA polymerase II transcription subunit 8 OS=Coccidioides immitis (strain RS) GN=MED8 PE=3 SV=1 6 173 8.0E-31
sp|Q2UGT1|MED8_ASPOR Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=med8 PE=3 SV=1 8 173 1.0E-27
sp|A1CXD6|MED8_NEOFI Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=med8 PE=3 SV=1 6 173 2.0E-27
sp|Q4WP83|MED8_ASPFU Mediator of RNA polymerase II transcription subunit 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=med8 PE=3 SV=1 6 173 7.0E-27
sp|A1CHE9|MED8_ASPCL Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=med8 PE=3 SV=1 8 173 1.0E-26
sp|A2QID5|MED8_ASPNC Mediator of RNA polymerase II transcription subunit 8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=med8 PE=3 SV=1 6 173 5.0E-25
sp|Q5BCL0|MED8_EMENI Mediator of RNA polymerase II transcription subunit 8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=med8 PE=3 SV=1 6 208 4.0E-22
sp|Q59TD3|MED8_CANAL Mediator of RNA polymerase II transcription subunit 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MED8 PE=3 SV=1 14 148 2.0E-07
sp|Q758L3|MED8_ASHGO Mediator of RNA polymerase II transcription subunit 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MED8 PE=3 SV=1 20 210 8.0E-07
sp|Q6CG02|MED8_YARLI Mediator of RNA polymerase II transcription subunit 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MED8 PE=3 SV=1 20 212 3.0E-06
sp|Q6BM45|MED8_DEBHA Mediator of RNA polymerase II transcription subunit 8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MED8 PE=3 SV=2 13 108 4.0E-06
sp|Q6FJM0|MED8_CANGA Mediator of RNA polymerase II transcription subunit 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MED8 PE=3 SV=1 20 111 9.0E-06
sp|P38304|MED8_YEAST Mediator of RNA polymerase II transcription subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MED8 PE=1 SV=3 20 120 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0008150 biological_process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0032991 protein-containing complex No
GO:0006355 regulation of transcription, DNA-templated No
GO:0009889 regulation of biosynthetic process No
GO:0005575 cellular_component No
GO:0065007 biological regulation No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5128
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4681 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4495
Ophiocordyceps camponoti-floridani Ophcf2|03310
Ophiocordyceps kimflemingae Ophio5|3526
Ophiocordyceps subramaniannii Hirsu2|3456

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4681
MATLGLDEDELKSIEQTLSRLSQLSSSIQSFKADILKSNPLPHPSSLQASAQIIQRNLQTVLDSVTENNQVLSRM
AVHPSTNFPGRTQENVLTQLLRKKLEPDVEELVGEGQAIANATTAAGMQVLQQVWDEVRAWTHARIASHVRDEAG
DVYTREEREAGVETVRTGLRRVLDEESEDGDDEDDEMAGGEGAQPTGPEIETLLWFASRGDFELPRHIEFERKTG
PLKRGLEGVNIPPQDAAVAGMGLMDESA*
Coding >OphauG2|4681
ATGGCGACGCTGGGGCTGGACGAAGACGAGCTCAAGTCGATTGAGCAGACGCTGTCAAGGCTATCTCAACTGTCA
AGCAGCATCCAGAGTTTCAAGGCCGATATTCTCAAGAGCAACCCTCTTCCTCATCCGTCGTCGTTGCAAGCGTCT
GCGCAAATCATCCAGCGAAACCTCCAAACAGTGCTGGACAGCGTGACGGAGAATAACCAAGTCCTATCGCGCATG
GCCGTGCACCCGTCGACCAATTTCCCCGGACGAACGCAAGAAAATGTCCTGACGCAGCTTCTGCGCAAGAAGCTC
GAGCCTGACGTGGAGGAGCTGGTGGGCGAGGGCCAAGCGATTGCGAATGCGACGACGGCGGCGGGGATGCAAGTG
CTGCAACAAGTATGGGACGAGGTGCGTGCGTGGACGCATGCGCGAATCGCGAGCCACGTGCGCGACGAGGCGGGC
GATGTGTATACGCGCGAGGAGCGCGAGGCGGGCGTGGAAACGGTACGAACAGGGCTACGCCGCGTGCTGGATGAA
GAGAGCGAGGATGGCGATGACGAGGATGACGAAATGGCTGGTGGCGAGGGGGCGCAGCCTACGGGTCCGGAAATC
GAGACGTTGTTGTGGTTTGCGTCGAGAGGGGATTTTGAATTGCCGCGGCATATAGAATTTGAGAGGAAGACGGGT
CCGTTGAAGAGGGGGCTCGAGGGCGTGAATATCCCGCCCCAAGACGCCGCGGTGGCGGGTATGGGCCTCATGGAT
GAGTCGGCGTGA
Transcript >OphauG2|4681
ATGGCGACGCTGGGGCTGGACGAAGACGAGCTCAAGTCGATTGAGCAGACGCTGTCAAGGCTATCTCAACTGTCA
AGCAGCATCCAGAGTTTCAAGGCCGATATTCTCAAGAGCAACCCTCTTCCTCATCCGTCGTCGTTGCAAGCGTCT
GCGCAAATCATCCAGCGAAACCTCCAAACAGTGCTGGACAGCGTGACGGAGAATAACCAAGTCCTATCGCGCATG
GCCGTGCACCCGTCGACCAATTTCCCCGGACGAACGCAAGAAAATGTCCTGACGCAGCTTCTGCGCAAGAAGCTC
GAGCCTGACGTGGAGGAGCTGGTGGGCGAGGGCCAAGCGATTGCGAATGCGACGACGGCGGCGGGGATGCAAGTG
CTGCAACAAGTATGGGACGAGGTGCGTGCGTGGACGCATGCGCGAATCGCGAGCCACGTGCGCGACGAGGCGGGC
GATGTGTATACGCGCGAGGAGCGCGAGGCGGGCGTGGAAACGGTACGAACAGGGCTACGCCGCGTGCTGGATGAA
GAGAGCGAGGATGGCGATGACGAGGATGACGAAATGGCTGGTGGCGAGGGGGCGCAGCCTACGGGTCCGGAAATC
GAGACGTTGTTGTGGTTTGCGTCGAGAGGGGATTTTGAATTGCCGCGGCATATAGAATTTGAGAGGAAGACGGGT
CCGTTGAAGAGGGGGCTCGAGGGCGTGAATATCCCGCCCCAAGACGCCGCGGTGGCGGGTATGGGCCTCATGGAT
GAGTCGGCGTGA
Gene >OphauG2|4681
ATGGCGACGCTGGGGCTGGACGAAGACGAGCTCAAGTCGATTGAGCAGACGCTGTCAAGGCTATCTCAACTGTCA
AGCAGCATCCAGAGTTTCAAGGCCGATATTCTCAAGAGCAACCCTCTTCCTCATCCGTGGGTGGACCATATTCAC
AAGAATTGTGCTATTTTCTTGGGCACTGGAAAACAAATTAACACGCTGTTTCTGTGGCATGGTGAAACAGGTCGT
CGTTGCAAGCGTCTGCGCAAATCATCCAGCGAAACCTCCAAACAGTGCTGGACAGCGTGACGGAGAATAACCAAG
TCCTATCGCGCATGGCCGTGCACCCGTCGACCAATTTCCCCGGACGAACGCAAGAAAATGTCCTGACGCAGCTTC
TGCGCAAGAAGCTCGAGCCTGACGTGGAGGAGCTGGTGGGCGAGGGCCAAGCGATTGCGAATGCGACGACGGCGG
CGGGGATGCAAGTGCTGCAACAAGTATGGGACGAGGTGCGTGCGTGGACGCATGCGCGAATCGCGAGCCACGTGC
GCGACGAGGCGGGCGATGTGTATACGCGCGAGGAGCGCGAGGCGGGCGTGGAAACGGTACGAACAGGGCTACGCC
GCGTGCTGGATGAAGAGAGCGAGGATGGCGATGACGAGGATGACGAAATGGCTGGTGGCGAGGGGGCGCAGCCTA
CGGGTCCGGAAATCGAGACGTTGTTGTGGTTTGCGTCGAGAGGGGATTTTGAATTGCCGCGGCATATAGAATTTG
AGAGGAAGACGGGTCCGTTGAAGAGGGGGCTCGAGGGCGTGAATATCCCGCCCCAAGACGCCGCGGTGGCGGGTA
TGGGCCTCATGGATGAGTCGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail