Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4676
Gene name
LocationContig_4:52416..56342
Strand+
Gene length (bp)3926
Transcript length (bp)3675
Coding sequence length (bp)3675
Protein length (aa) 1225

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03033 Glyco_transf_28 Glycosyltransferase family 28 N-terminal domain 4.4E-10 127 184
PF00201 UDPGT UDP-glucoronosyl and UDP-glucosyl transferase 5.8E-05 415 549

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Z7|U80A2_ARATH Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana GN=UGT80A2 PE=1 SV=1 123 578 1.0E-121
sp|Q9XIG1|U80B1_ARATH Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana GN=UGT80B1 PE=2 SV=1 123 581 3.0E-120
sp|Q0UY53|ATG26_PHANO Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG26 PE=3 SV=1 106 579 2.0E-78
sp|Q8NJS1|ATG26_LEPMC Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans GN=ATG26 PE=3 SV=1 79 579 3.0E-77
sp|Q6C8M8|ATG26_YARLI Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG26 PE=3 SV=3 104 579 2.0E-76
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Z7|U80A2_ARATH Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana GN=UGT80A2 PE=1 SV=1 123 578 1.0E-121
sp|Q9XIG1|U80B1_ARATH Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana GN=UGT80B1 PE=2 SV=1 123 581 3.0E-120
sp|Q0UY53|ATG26_PHANO Sterol 3-beta-glucosyltransferase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG26 PE=3 SV=1 106 579 2.0E-78
sp|Q8NJS1|ATG26_LEPMC Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans GN=ATG26 PE=3 SV=1 79 579 3.0E-77
sp|Q6C8M8|ATG26_YARLI Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG26 PE=3 SV=3 104 579 2.0E-76
sp|P0CN91|ATG26_CRYNB Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG26 PE=3 SV=1 119 607 3.0E-76
sp|A7A179|ATG26_YEAS7 Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG26 PE=3 SV=1 132 586 6.0E-76
sp|P0CN90|ATG26_CRYNJ Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG26 PE=3 SV=1 119 579 7.0E-76
sp|Q5B4C9|ATG26_EMENI Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg26 PE=3 SV=1 121 579 2.0E-75
sp|Q06321|ATG26_YEAST Sterol 3-beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG26 PE=1 SV=1 132 586 2.0E-75
sp|A1CYS1|ATG26_NEOFI Sterol 3-beta-glucosyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg26 PE=3 SV=1 121 579 4.0E-75
sp|A7KAN4|ATG26_PENRW Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg26 PE=3 SV=1 121 579 9.0E-75
sp|A7KAK6|ATG26_PICAN Sterol 3-beta-glucosyltransferase OS=Pichia angusta GN=ATG26 PE=3 SV=1 132 579 1.0E-74
sp|Q4WID6|ATG26_ASPFU Sterol 3-beta-glucosyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg26 PE=3 SV=2 121 579 2.0E-74
sp|A2QNQ5|ATG26_ASPNC Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg26 PE=3 SV=2 121 579 2.0E-74
sp|A1CFB3|ATG26_ASPCL Sterol 3-beta-glucosyltransferase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg26 PE=3 SV=1 121 579 2.0E-74
sp|Q0CKU4|ATG26_ASPTN Sterol 3-beta-glucosyltransferase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg26 PE=3 SV=1 121 579 2.0E-74
sp|Q5A950|ATG26_CANAL Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG26 PE=3 SV=1 121 579 4.0E-74
sp|A7TF84|ATG26_VANPO Sterol 3-beta-glucosyltransferase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG26 PE=3 SV=1 120 579 1.0E-73
sp|Q9Y751|ATG26_PICPG Sterol 3-beta-glucosyltransferase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ATG26 PE=3 SV=1 128 595 2.0E-73
sp|Q54IL5|UGT52_DICDI UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum GN=ugt52 PE=2 SV=1 120 578 5.0E-73
sp|Q2U0C3|ATG26_ASPOR Sterol 3-beta-glucosyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg26 PE=3 SV=2 121 579 7.0E-73
sp|Q7S1I0|ATG26_NEUCR Sterol 3-beta-glucosyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-12 PE=3 SV=1 121 579 1.0E-71
sp|Q6BN88|ATG26_DEBHA Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG26 PE=3 SV=2 121 579 2.0E-70
sp|Q751Z4|ATG26_ASHGO Sterol 3-beta-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG26 PE=3 SV=2 132 573 3.0E-70
sp|Q6CUV2|ATG26_KLULA Sterol 3-beta-glucosyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG26 PE=3 SV=1 132 578 6.0E-70
sp|A7ERM5|ATG26_SCLS1 Sterol 3-beta-glucosyltransferase OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg26 PE=3 SV=1 121 579 2.0E-66
sp|O70023|TYLN_STRFR O-mycaminosyltylonolide 6-deoxyallosyltransferase OS=Streptomyces fradiae GN=tylN PE=1 SV=2 125 568 2.0E-39
sp|P96559|GTFB_AMYOR Vancomycin aglycone glucosyltransferase OS=Amycolatopsis orientalis GN=gtfB PE=1 SV=1 277 569 7.0E-28
sp|Q9AFC6|GTFE_AMYOR Glycosyltransferase GtfE OS=Amycolatopsis orientalis GN=gtfE PE=3 SV=1 403 557 2.0E-22
sp|Q9AFC7|GTFD_AMYOR Desvancosaminyl-vancomycin vancosaminetransferase OS=Amycolatopsis orientalis GN=gtfD PE=1 SV=1 277 557 4.0E-22
sp|P96560|GTFC_AMYOR Glycosyltransferase GtfC OS=Amycolatopsis orientalis GN=gtfC PE=1 SV=1 277 569 7.0E-22
sp|Q49929|Y2348_MYCLE Uncharacterized glycosyltransferase ML2348 OS=Mycobacterium leprae (strain TN) GN=ML2348 PE=3 SV=1 133 563 1.0E-21
sp|P64870|Y1553_MYCBO Uncharacterized protein Mb1553c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1553c PE=4 SV=1 125 561 1.0E-19
sp|P9WLV1|Y1526_MYCTU Uncharacterized protein Rv1526c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1526c PE=4 SV=1 125 561 1.0E-19
sp|P9WLV0|Y1526_MYCTO Uncharacterized protein MT1577 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1577 PE=4 SV=1 125 561 1.0E-19
sp|P9WN07|Y1524_MYCTU Uncharacterized glycosyltransferase Rv1524 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1524 PE=1 SV=1 392 567 1.0E-17
sp|P9WN06|Y1524_MYCTO Uncharacterized glycosyltransferase MT1575 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1575 PE=3 SV=1 392 567 1.0E-17
sp|P64866|Y1551_MYCBO Uncharacterized glycosyltransferase Mb1551 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1551 PE=3 SV=1 392 567 1.0E-17
sp|P96558|GTFA_AMYOR dTDP-epi-vancosaminyltransferase OS=Amycolatopsis orientalis GN=gtfA PE=1 SV=1 125 584 8.0E-16
sp|Q9BGZ0|VP13A_MACFA Vacuolar protein sorting-associated protein 13A (Fragment) OS=Macaca fascicularis GN=VPS13A PE=2 SV=1 831 899 3.0E-12
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 831 899 1.0E-11
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 834 899 2.0E-11
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 830 900 5.0E-10
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 830 900 5.0E-10
sp|Q86K84|VP13L_DICDI Vacuolar protein sorting-associated protein 13-like protein OS=Dictyostelium discoideum GN=vps13l PE=3 SV=1 783 899 2.0E-09
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 842 900 5.0E-08
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 827 934 6.0E-08
sp|P95747|TYLM2_STRFR Tylactone mycaminosyltransferase OS=Streptomyces fradiae GN=tylMII PE=1 SV=3 461 557 8.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008194 UDP-glycosyltransferase activity Yes
GO:0016758 hexosyltransferase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030259 lipid glycosylation Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0070085 glycosylation No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0016757 glycosyltransferase activity No
GO:0030258 lipid modification No
GO:0016740 transferase activity No
GO:0044255 cellular lipid metabolic process No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4676
MQHLLDDKQRLAAQQAGAKQGSSEDAYQSLVADGYVLPTLDAPDDMPPAYGEHHDQLQFSQAGFDAGAAVTDDGR
VNINIATKSRRLADLLAPVIDRQFTPDALPPAYIPSSLGGHDDEIPPPPLNVVVQIVGSRGDVQPFVSLGKVLKT
KYGHRVRIATHATFQGFVEENGLEFFNIGGDPAELMAFMVKYPGLMPGIDAVKSGEICKRRKGIQDMILGCWRSC
IEAGNGLGPPPKPHGHNEPLDLPTGIPGHGNQPPFVADAIIANPPSFAHIHVAEKLGIPLHMMFTMPWSPTKAFP
HPLANVQSSNANDVITNHLTYTLVEMMTWQGLGDVINRFRDKVLGLSPLSLASGAGLLTRLKIPYTYCWSPSLIP
KPNDWNINIDIAGFFFLDLASSFTPDAELDAFLEAGPPPVYIGFGSIVVDDADAMTRMIFDAIRLAGVRALVSKG
WGGLGADQLGVPANVLMLGNVPHDWLFQRVSCVVHHGGAGTTAAGIKAGKPTVVVPFFGDQPFWGSMIAKAKAGP
EPIPYKALTAEKLAAAIRLCLESETKQRAQALGFKIRQEHGSEAGAQSFHSHLDVESLTCSLAPSRTAAWRIRRT
KFRLSALAAAVLVEQGLIDYTDVKLHRPSEYHTENQPFDPISAGACSLVGDMSSIGMAIADMPREMFRYGRRAAD
KSLAASSSSGSTTPGPESLHTDSSVSEHSIRVPPAPSRRSSMKLASGSGSPSTSQSSLMSPTGATSIYDGTENRN
SPRKATLTTSPTKQKVACRDSLPVGVSIGAALGAGRGVGRAVSTGVKSPMNFCLGLAKGFRNMPLLYHDETIRPV
EKVTDFSSGIKVAGKELGYGFFDGIAGLVTQPLRGAEKEGAGGFVKGFGKGIGGLIAKPAAGIWGVPAYTMQGVH
AEIKNLFATSAHNYILTSRILQGRQELQEVTPQEKADIVNRWNSARHHVENFHLMKRKQKSRDRDGQASTESRFA
RHKAYWREHARRSSVQDKGNLQRRAGAEAAVSHRSSSGLGIQQPMGSHEVALEEAIEASVRETSRGDAAEDGAVE
SAIRQSIQAIQHRGALGNETAVALKTETQISSIFEEDEWRITDEEYQHLIQQAIEKSLSHHVKAPTQQEGLLDSN
MAATEDNGLAADRRGLPHYDQEDAALKRAMEESTRVARPHRGNEEDEELQRAIAASREDMERREREQTEEQVVLE
YIKRQSLVEEEYRHKMNNTRDRGI*
Coding >OphauG2|4676
ATGCAGCATTTGCTAGACGACAAGCAGAGGCTGGCGGCGCAACAAGCAGGCGCCAAGCAAGGCTCTTCTGAAGAT
GCATACCAGTCGCTTGTGGCGGATGGCTATGTCTTGCCGACCCTCGATGCGCCAGACGACATGCCGCCTGCGTAC
GGCGAGCATCATGACCAGCTTCAGTTTTCGCAGGCCGGCTTCGATGCTGGCGCTGCCGTGACGGACGATGGCCGC
GTCAATATCAATATCGCCACCAAGAGCAGGCGTCTGGCCGACTTGCTGGCGCCCGTCATTGACAGACAGTTTACC
CCAGATGCGCTGCCCCCCGCCTACATTCCCTCGAGCCTGGGCGGCCACGATGACGAGATTCCTCCGCCGCCTCTC
AATGTGGTGGTGCAGATTGTTGGCTCTCGAGGCGATGTTCAGCCCTTTGTATCGCTGGGCAAGGTGCTCAAGACC
AAGTACGGCCATCGCGTGCGCATTGCAACCCACGCTACCTTCCAGGGCTTTGTCGAGGAAAATGGCCTCGAATTC
TTCAATATTGGAGGCGATCCAGCCGAGCTCATGGCTTTCATGGTCAAGTATCCAGGCCTCATGCCTGGCATCGAT
GCCGTCAAGAGCGGCGAGATTTGCAAGCGCCGCAAAGGCATTCAGGATATGATACTGGGCTGCTGGAGATCGTGC
ATCGAGGCTGGAAACGGCCTCGGCCCCCCGCCTAAGCCCCATGGCCACAACGAGCCTCTCGACTTGCCCACTGGA
ATTCCTGGCCATGGAAACCAGCCGCCGTTTGTTGCCGATGCCATCATTGCCAATCCTCCCAGCTTTGCCCATATC
CATGTGGCTGAGAAGCTGGGCATTCCCCTTCACATGATGTTTACCATGCCATGGTCGCCTACTAAGGCCTTCCCG
CACCCTCTTGCTAACGTCCAGTCGTCGAATGCTAACGACGTCATAACAAACCATCTCACCTACACGCTTGTCGAG
ATGATGACGTGGCAGGGCCTAGGAGATGTCATCAACCGCTTTCGTGACAAAGTTCTTGGCCTCAGCCCACTGTCC
TTGGCCTCGGGTGCTGGCCTCCTCACTCGCCTCAAGATTCCCTACACGTATTGCTGGTCGCCGTCCCTAATACCC
AAACCGAACGACTGGAACATCAACATTGACATTGCGGGGTTTTTCTTTCTCGATTTGGCATCTTCCTTCACCCCT
GATGCGGAACTCGACGCATTTCTCGAAGCTGGGCCTCCTCCTGTTTACATTGGATTTGGCTCCATCGTAGTTGAC
GATGCCGATGCAATGACGCGTATGATATTCGATGCCATACGCTTGGCAGGTGTCAGAGCGCTCGTGTCTAAAGGC
TGGGGCGGCTTAGGCGCCGACCAACTCGGCGTCCCAGCCAACGTCTTGATGCTTGGTAATGTTCCTCACGACTGG
CTCTTTCAACGCGTGTCGTGTGTTGTTCATCATGGTGGAGCCGGTACCACTGCTGCCGGTATCAAAGCTGGCAAG
CCGACGGTGGTTGTTCCTTTTTTCGGAGATCAGCCTTTCTGGGGCTCCATGATAGCTAAAGCCAAGGCTGGCCCT
GAGCCCATACCTTACAAAGCCTTGACTGCGGAAAAATTGGCAGCAGCAATCCGGCTTTGCCTCGAGTCAGAGACA
AAGCAACGAGCCCAGGCCTTGGGGTTTAAAATCAGGCAAGAGCACGGCTCTGAAGCCGGGGCTCAGAGCTTCCAT
AGCCATCTCGACGTTGAGTCATTGACATGCTCCTTGGCTCCCAGCAGGACAGCGGCATGGAGAATCCGCCGGACC
AAGTTTCGACTGAGTGCTCTGGCCGCGGCTGTCTTGGTCGAACAAGGCCTGATTGATTATACTGATGTCAAGCTA
CATCGTCCAAGCGAGTACCATACGGAAAACCAGCCGTTCGATCCCATCTCGGCCGGAGCTTGCTCTCTGGTCGGA
GACATGAGCAGCATTGGCATGGCCATAGCCGACATGCCGCGAGAGATGTTTAGATATGGTCGACGGGCTGCTGAC
AAGTCTTTGGCCGCAAGCTCCAGTTCTGGTAGTACGACGCCAGGACCCGAGAGTCTTCACACAGATTCTAGTGTT
TCCGAGCATTCGATTCGTGTCCCACCAGCTCCAAGCCGCAGATCTAGTATGAAGCTGGCTTCCGGGTCTGGCAGC
CCGTCTACATCGCAAAGTTCTTTAATGTCTCCCACTGGCGCCACAAGCATATATGACGGGACTGAGAATCGAAAC
TCGCCAAGAAAAGCCACGCTTACCACTTCACCAACCAAACAGAAAGTAGCCTGTAGGGACTCTTTACCAGTTGGC
GTTAGTATTGGTGCCGCCCTAGGCGCTGGCAGGGGAGTCGGTCGTGCCGTCTCAACTGGTGTCAAGTCGCCCATG
AACTTTTGTCTAGGGCTGGCCAAGGGGTTCAGAAACATGCCGCTCCTGTATCACGATGAGACAATCCGGCCAGTG
GAGAAAGTTACCGACTTTAGTAGCGGAATCAAGGTTGCGGGTAAAGAACTAGGCTACGGCTTCTTTGACGGCATT
GCGGGTCTGGTCACTCAGCCACTCCGAGGGGCTGAGAAGGAGGGAGCTGGTGGGTTTGTCAAGGGCTTTGGCAAA
GGCATTGGTGGTCTCATCGCCAAACCAGCTGCAGGAATATGGGGCGTTCCGGCTTATACGATGCAAGGAGTCCAT
GCTGAAATCAAGAATCTTTTTGCAACCAGCGCCCACAATTACATTCTCACTTCTAGAATTCTACAGGGACGGCAG
GAGCTTCAAGAGGTGACTCCACAAGAAAAGGCAGATATTGTAAACCGTTGGAACAGCGCTAGGCATCATGTCGAA
AATTTCCACTTGATGAAGCGGAAACAGAAGTCGAGAGACCGAGATGGACAGGCATCGACAGAGTCACGCTTTGCA
CGCCACAAAGCATACTGGAGGGAACACGCTCGCCGGTCGTCAGTCCAAGATAAAGGAAATTTACAGAGGCGAGCT
GGAGCTGAAGCAGCCGTGTCGCATCGGTCGAGCAGTGGCTTGGGTATTCAACAGCCCATGGGATCCCATGAGGTG
GCCCTCGAAGAGGCAATCGAGGCGTCGGTGCGAGAGACATCACGCGGCGATGCAGCAGAGGATGGTGCAGTTGAA
AGTGCAATTCGGCAGAGTATTCAAGCAATACAACATCGAGGAGCTCTTGGCAACGAAACTGCCGTTGCGCTCAAA
ACCGAGACACAGATCAGCAGCATATTTGAAGAGGACGAGTGGCGAATTACAGACGAGGAGTACCAGCATCTTATT
CAGCAGGCTATTGAAAAGAGCTTGTCCCATCACGTCAAGGCGCCGACTCAGCAAGAAGGCCTTTTGGATTCAAAC
ATGGCAGCTACTGAAGACAATGGGCTAGCTGCAGATAGACGTGGGCTGCCACATTACGACCAAGAAGACGCGGCA
CTGAAACGAGCCATGGAGGAGTCTACAAGAGTCGCGAGGCCGCATAGGGGCAATGAGGAAGATGAAGAGCTTCAA
CGGGCCATTGCAGCGTCGAGAGAGGACATGGAGCGAAGGGAGAGGGAGCAGACAGAGGAACAAGTGGTGCTCGAA
TACATCAAGAGACAAAGTCTGGTCGAGGAAGAATACCGTCATAAAATGAATAATACACGAGACAGGGGGATATAG
Transcript >OphauG2|4676
ATGCAGCATTTGCTAGACGACAAGCAGAGGCTGGCGGCGCAACAAGCAGGCGCCAAGCAAGGCTCTTCTGAAGAT
GCATACCAGTCGCTTGTGGCGGATGGCTATGTCTTGCCGACCCTCGATGCGCCAGACGACATGCCGCCTGCGTAC
GGCGAGCATCATGACCAGCTTCAGTTTTCGCAGGCCGGCTTCGATGCTGGCGCTGCCGTGACGGACGATGGCCGC
GTCAATATCAATATCGCCACCAAGAGCAGGCGTCTGGCCGACTTGCTGGCGCCCGTCATTGACAGACAGTTTACC
CCAGATGCGCTGCCCCCCGCCTACATTCCCTCGAGCCTGGGCGGCCACGATGACGAGATTCCTCCGCCGCCTCTC
AATGTGGTGGTGCAGATTGTTGGCTCTCGAGGCGATGTTCAGCCCTTTGTATCGCTGGGCAAGGTGCTCAAGACC
AAGTACGGCCATCGCGTGCGCATTGCAACCCACGCTACCTTCCAGGGCTTTGTCGAGGAAAATGGCCTCGAATTC
TTCAATATTGGAGGCGATCCAGCCGAGCTCATGGCTTTCATGGTCAAGTATCCAGGCCTCATGCCTGGCATCGAT
GCCGTCAAGAGCGGCGAGATTTGCAAGCGCCGCAAAGGCATTCAGGATATGATACTGGGCTGCTGGAGATCGTGC
ATCGAGGCTGGAAACGGCCTCGGCCCCCCGCCTAAGCCCCATGGCCACAACGAGCCTCTCGACTTGCCCACTGGA
ATTCCTGGCCATGGAAACCAGCCGCCGTTTGTTGCCGATGCCATCATTGCCAATCCTCCCAGCTTTGCCCATATC
CATGTGGCTGAGAAGCTGGGCATTCCCCTTCACATGATGTTTACCATGCCATGGTCGCCTACTAAGGCCTTCCCG
CACCCTCTTGCTAACGTCCAGTCGTCGAATGCTAACGACGTCATAACAAACCATCTCACCTACACGCTTGTCGAG
ATGATGACGTGGCAGGGCCTAGGAGATGTCATCAACCGCTTTCGTGACAAAGTTCTTGGCCTCAGCCCACTGTCC
TTGGCCTCGGGTGCTGGCCTCCTCACTCGCCTCAAGATTCCCTACACGTATTGCTGGTCGCCGTCCCTAATACCC
AAACCGAACGACTGGAACATCAACATTGACATTGCGGGGTTTTTCTTTCTCGATTTGGCATCTTCCTTCACCCCT
GATGCGGAACTCGACGCATTTCTCGAAGCTGGGCCTCCTCCTGTTTACATTGGATTTGGCTCCATCGTAGTTGAC
GATGCCGATGCAATGACGCGTATGATATTCGATGCCATACGCTTGGCAGGTGTCAGAGCGCTCGTGTCTAAAGGC
TGGGGCGGCTTAGGCGCCGACCAACTCGGCGTCCCAGCCAACGTCTTGATGCTTGGTAATGTTCCTCACGACTGG
CTCTTTCAACGCGTGTCGTGTGTTGTTCATCATGGTGGAGCCGGTACCACTGCTGCCGGTATCAAAGCTGGCAAG
CCGACGGTGGTTGTTCCTTTTTTCGGAGATCAGCCTTTCTGGGGCTCCATGATAGCTAAAGCCAAGGCTGGCCCT
GAGCCCATACCTTACAAAGCCTTGACTGCGGAAAAATTGGCAGCAGCAATCCGGCTTTGCCTCGAGTCAGAGACA
AAGCAACGAGCCCAGGCCTTGGGGTTTAAAATCAGGCAAGAGCACGGCTCTGAAGCCGGGGCTCAGAGCTTCCAT
AGCCATCTCGACGTTGAGTCATTGACATGCTCCTTGGCTCCCAGCAGGACAGCGGCATGGAGAATCCGCCGGACC
AAGTTTCGACTGAGTGCTCTGGCCGCGGCTGTCTTGGTCGAACAAGGCCTGATTGATTATACTGATGTCAAGCTA
CATCGTCCAAGCGAGTACCATACGGAAAACCAGCCGTTCGATCCCATCTCGGCCGGAGCTTGCTCTCTGGTCGGA
GACATGAGCAGCATTGGCATGGCCATAGCCGACATGCCGCGAGAGATGTTTAGATATGGTCGACGGGCTGCTGAC
AAGTCTTTGGCCGCAAGCTCCAGTTCTGGTAGTACGACGCCAGGACCCGAGAGTCTTCACACAGATTCTAGTGTT
TCCGAGCATTCGATTCGTGTCCCACCAGCTCCAAGCCGCAGATCTAGTATGAAGCTGGCTTCCGGGTCTGGCAGC
CCGTCTACATCGCAAAGTTCTTTAATGTCTCCCACTGGCGCCACAAGCATATATGACGGGACTGAGAATCGAAAC
TCGCCAAGAAAAGCCACGCTTACCACTTCACCAACCAAACAGAAAGTAGCCTGTAGGGACTCTTTACCAGTTGGC
GTTAGTATTGGTGCCGCCCTAGGCGCTGGCAGGGGAGTCGGTCGTGCCGTCTCAACTGGTGTCAAGTCGCCCATG
AACTTTTGTCTAGGGCTGGCCAAGGGGTTCAGAAACATGCCGCTCCTGTATCACGATGAGACAATCCGGCCAGTG
GAGAAAGTTACCGACTTTAGTAGCGGAATCAAGGTTGCGGGTAAAGAACTAGGCTACGGCTTCTTTGACGGCATT
GCGGGTCTGGTCACTCAGCCACTCCGAGGGGCTGAGAAGGAGGGAGCTGGTGGGTTTGTCAAGGGCTTTGGCAAA
GGCATTGGTGGTCTCATCGCCAAACCAGCTGCAGGAATATGGGGCGTTCCGGCTTATACGATGCAAGGAGTCCAT
GCTGAAATCAAGAATCTTTTTGCAACCAGCGCCCACAATTACATTCTCACTTCTAGAATTCTACAGGGACGGCAG
GAGCTTCAAGAGGTGACTCCACAAGAAAAGGCAGATATTGTAAACCGTTGGAACAGCGCTAGGCATCATGTCGAA
AATTTCCACTTGATGAAGCGGAAACAGAAGTCGAGAGACCGAGATGGACAGGCATCGACAGAGTCACGCTTTGCA
CGCCACAAAGCATACTGGAGGGAACACGCTCGCCGGTCGTCAGTCCAAGATAAAGGAAATTTACAGAGGCGAGCT
GGAGCTGAAGCAGCCGTGTCGCATCGGTCGAGCAGTGGCTTGGGTATTCAACAGCCCATGGGATCCCATGAGGTG
GCCCTCGAAGAGGCAATCGAGGCGTCGGTGCGAGAGACATCACGCGGCGATGCAGCAGAGGATGGTGCAGTTGAA
AGTGCAATTCGGCAGAGTATTCAAGCAATACAACATCGAGGAGCTCTTGGCAACGAAACTGCCGTTGCGCTCAAA
ACCGAGACACAGATCAGCAGCATATTTGAAGAGGACGAGTGGCGAATTACAGACGAGGAGTACCAGCATCTTATT
CAGCAGGCTATTGAAAAGAGCTTGTCCCATCACGTCAAGGCGCCGACTCAGCAAGAAGGCCTTTTGGATTCAAAC
ATGGCAGCTACTGAAGACAATGGGCTAGCTGCAGATAGACGTGGGCTGCCACATTACGACCAAGAAGACGCGGCA
CTGAAACGAGCCATGGAGGAGTCTACAAGAGTCGCGAGGCCGCATAGGGGCAATGAGGAAGATGAAGAGCTTCAA
CGGGCCATTGCAGCGTCGAGAGAGGACATGGAGCGAAGGGAGAGGGAGCAGACAGAGGAACAAGTGGTGCTCGAA
TACATCAAGAGACAAAGTCTGGTCGAGGAAGAATACCGTCATAAAATGAATAATACACGAGACAGGGGGATATAG
Gene >OphauG2|4676
ATGCAGCATTTGCTAGACGACAAGCAGAGGCTGGCGGCGCAACAAGCAGGCGCCAAGCAAGGCTCTTCTGAAGAT
GCATACCAGTCGCTTGTGGCGGATGGCTATGTCTTGCCGACCCTCGATGCGCCAGACGACATGCCGCCTGCGTAC
GGCGAGCATCATGACCAGCTTCAGTTTTCGCAGGCCGGCTTCGATGCTGGCGCTGCCGTGACGGGTGAGTCGAGG
AGGCATCAACACGAGCGCATGGCATGGGGCAAGCGTGTTGATACGAGGCAGACGATGGCCGCGTCAATATCAATA
TCGCCACCAAGAGCAGGCGTCTGGCCGACTTGCTGGCGCCCGTCATTGACAGACAGTTTACCCCAGATGCGCTGC
CCCCCGCCTACATTCCCTCGAGCCTGGGCGGCCACGATGACGAGATTCCTCCGCCGCCTCTCAATGTGGTGGTGC
AGATTGTTGGCTCTCGAGGCGATGTTCAGCCCTTTGTATCGCTGGGCAAGGTGCTCAAGACCAAGTACGGCCATC
GCGTGCGCATTGCAACCCACGCTACCTTCCAGGGCTTTGTCGAGGAAAATGGCCTCGAATTCTTCAATATTGGAG
GCGATCCAGCCGAGCTCATGGCTTTCATGGTCAAGTATCCAGGCCTCATGCCTGGCATCGATGCCGTCAAGAGCG
GCGAGATTTGCAAGCGCCGCAAAGGCATTCAGGATATGATACTGGGCTGCTGGAGATCGTGCATCGAGGCTGGAA
ACGGCCTCGGCCCCCCGCCTAAGCCCCATGGCCACAACGAGCCTCTCGACTTGCCCACTGGAATTCCTGGCCATG
GAAACCAGCCGCCGTTTGTTGCCGATGCCATCATTGCCAATCCTCCCAGCTTTGCCCATATCCATGTGGCTGAGA
AGCTGGGCATTCCCCTTCACATGATGTTTACGTGAGTGAGCAGGCGCTTTGCCATGTTGGTCTGGCTTGGGCTTA
TATCTTTGCTTCTCCCTCAGCATGCCATGGTCGCCTACTAAGGCCTTCCCGCACCCTCTTGCTAACGTCCAGTCG
TCGAATGCTAACGACGTCATAACAAACCATCTCACCTACACGCTTGTCGAGATGATGACGTGGCAGGGCCTAGGA
GATGTCATCAACCGCTTTCGTGACAAAGTTCTTGGCCTCAGCCCACTGTCCTTGGCCTCGGGTGCTGGCCTCCTC
ACTCGCCTCAAGATTCCCTACACGTATTGCTGGTCGCCGTCCCTAATACCCAAACCGAACGACTGGAACATCAAC
ATTGACATTGCGGGGTTTTTCTTTCTCGATTTGGCATCTTCCTTCACCCCTGATGCGGAACTCGACGCATTTCTC
GAAGCTGGGCCTCCTCCTGTTTACATTGGATTTGGCTCCATCGTAGTTGACGATGCCGATGCAATGACGCGTATG
ATATTCGATGCCATACGCTTGGCAGGTGTCAGAGCGCTCGTGTCTAAAGGCTGGGGCGGCTTAGGCGCCGACCAA
CTCGGCGTCCCAGCCAACGTCTTGATGCTTGGTAATGTTCCTCACGACTGGCTCTTTCAACGCGTGTCGTGTGTT
GTTCATCATGGTGGAGCCGGTACCACTGCTGCCGGTATCAAAGCTGGCAAGCCGACGGTGGTTGTTCCTTTTTTC
GGAGATCAGCCTTTCTGGGGCTCCATGATAGCTAAAGCCAAGGCTGGCCCTGAGCCCATACCTTACAAAGCCTTG
ACTGCGGAAAAATTGGCAGCAGCAATCCGGCTTTGCCTCGAGTCAGAGACAAAGCAACGAGCCCAGGCCTTGGGG
TTTAAAATCAGGCAAGAGCACGGCTCTGAAGCCGGGGCTCAGAGCTTCCATAGCCATCTCGACGTTGAGTCATTG
ACATGCTCCTTGGCTCCCAGCAGGACAGCGGCATGGAGAATCCGCCGGACCAAGTTTCGACTGAGTGCTCTGGCC
GCGGCTGTCTTGGTCGAACAAGGCCTGATTGATTATACTGATGTCAAGCTGTAAGACAAGAAGCAGCTCCGCTTT
GTGACGCCTTGCGCTGATTACAAGGCTTCAGACATCGTCCAAGCGAGTACCATACGGAAAACCAGCCGTTCGATC
CCATCTCGGCCGGAGCTTGCTCTCTGGTCGGAGACATGAGCAGCATTGGCATGGCCATAGCCGACATGCCGCGAG
AGATGTTTAGATATGGTCGACGGGCTGCTGACAAGTCTTTGGCCGCAAGCTCCAGTTCTGGTAGTACGACGCCAG
GACCCGAGAGTCTTCACACAGATTCTAGTGTTTCCGAGCATTCGATTCGTGTCCCACCAGCTCCAAGCCGCAGAT
CTAGTATGAAGCTGGCTTCCGGGTCTGGCAGCCCGTCTACATCGCAAAGTTCTTTAATGTCTCCCACTGGCGCCA
CAAGCATATATGACGGGACTGAGAATCGAAACTCGCCAAGAAAAGCCACGCTTACCACTTCACCAACCAAACAGA
AAGTAGCCTGTAGGGACTCTTTACCAGTTGGCGTTAGTATTGGTGCCGCCCTAGGCGCTGGCAGGGGAGTCGGTC
GTGCCGTCTCAACTGGTGTCAAGTCGCCCATGAACTTTTGTCTAGGGCTGGCCAAGGGGTTCAGAAACATGCCGC
TCCTGTATCACGATGAGACAATCCGGCCAGTGGAGAAAGTTACCGACTTTAGTAGCGGAATCAAGGTTGCGGGTA
AAGAACTAGGCTACGGCTTCTTTGACGGCATTGCGGGTCTGGTCACTCAGCCACTCCGAGGGGCTGAGAAGGAGG
GAGCTGGTGGGTTTGTCAAGGGCTTTGGCAAAGGCATTGGTGGTCTCATCGCCAAACCAGCTGCAGGTAAGCCCT
GGCTCTGGCATTTGATGCCGAGAACAGCTCTGGACAAGTGCTAACGCCTCGACTGTATAGGAATATGGGGCGTTC
CGGCTTATACGATGCAAGGAGTCCATGCTGAAATCAAGAATCTTTTTGCAACCAGCGCCCACAATTACATTCTCA
CTTCTAGAATTCTACAGGGACGGCAGGAGCTTCAAGAGGTGACTCCACAAGAAAAGGCAGATATTGTAAACCGTT
GGAACAGCGCTAGGCATCATGTCGAAAATTTCCACTTGATGAAGCGGAAACAGAAGTCGAGAGACCGAGATGGAC
AGGCATCGACAGAGTCACGCTTTGCACGCCACAAAGCATACTGGAGGGAACACGCTCGCCGGTCGTCAGTCCAAG
ATAAAGGAAATTTACAGAGGCGAGCTGGAGCTGAAGCAGCCGTGTCGCATCGGTCGAGCAGTGGCTTGGGTATTC
AACAGCCCATGGGATCCCATGAGGTGGCCCTCGAAGAGGCAATCGAGGCGTCGGTGCGAGAGACATCACGCGGCG
ATGCAGCAGAGGATGGTGCAGTTGAAAGTGCAATTCGGCAGAGTATTCAAGCAATACAACATCGAGGAGCTCTTG
GCAACGAAACTGCCGTTGCGCTCAAAACCGAGACACAGATCAGCAGCATATTTGAAGAGGACGAGTGGCGAATTA
CAGACGAGGAGTACCAGCATCTTATTCAGCAGGCTATTGAAAAGAGCTTGTCCCATCACGTCAAGGCGCCGACTC
AGCAAGAAGGCCTTTTGGATTCAAACATGGCAGCTACTGAAGACAATGGGCTAGCTGCAGATAGACGTGGGCTGC
CACATTACGACCAAGAAGACGCGGCACTGAAACGAGCCATGGAGGAGTCTACAAGAGTCGCGAGGCCGCATAGGG
GCAATGAGGAAGATGAAGAGCTTCAACGGGCCATTGCAGCGTCGAGAGAGGACATGGAGCGAAGGGAGAGGGAGC
AGACAGAGGAACAAGTGGTGCTCGAATACATCAAGAGACAAAGTCTGGTCGAGGAAGAATACCGTCATAAAATGA
ATAATACACGAGACAGGGGGATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail