Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4675
Gene name
LocationContig_4:51246..51814
Strand+
Gene length (bp)568
Transcript length (bp)342
Coding sequence length (bp)342
Protein length (aa) 114

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03911 Sec61_beta Sec61beta family 9.0E-19 65 105

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFC7|SC61B_YARLI Protein transport protein Sec61 subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SBH1 PE=3 SV=1 25 111 2.0E-32
sp|Q8J2P4|SC61B_KLULA Protein transport protein Sec61 subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SBH1 PE=3 SV=1 30 108 1.0E-28
sp|P52871|SC6B2_YEAST Protein transport protein SBH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH2 PE=1 SV=1 28 109 5.0E-26
sp|O43002|SC61B_SCHPO Protein transport protein sec61 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sbh1 PE=3 SV=1 23 113 5.0E-21
sp|P52870|SC6B1_YEAST Protein transport protein SBH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH1 PE=1 SV=1 25 111 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFC7|SC61B_YARLI Protein transport protein Sec61 subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SBH1 PE=3 SV=1 25 111 2.0E-32
sp|Q8J2P4|SC61B_KLULA Protein transport protein Sec61 subunit beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SBH1 PE=3 SV=1 30 108 1.0E-28
sp|P52871|SC6B2_YEAST Protein transport protein SBH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH2 PE=1 SV=1 28 109 5.0E-26
sp|O43002|SC61B_SCHPO Protein transport protein sec61 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sbh1 PE=3 SV=1 23 113 5.0E-21
sp|P52870|SC6B1_YEAST Protein transport protein SBH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SBH1 PE=1 SV=1 25 111 3.0E-18
sp|Q5RB31|SC61B_PONAB Protein transport protein Sec61 subunit beta OS=Pongo abelii GN=SEC61B PE=3 SV=3 36 109 1.0E-12
sp|P60468|SC61B_HUMAN Protein transport protein Sec61 subunit beta OS=Homo sapiens GN=SEC61B PE=1 SV=2 36 109 1.0E-12
sp|P60467|SC61B_CANLF Protein transport protein Sec61 subunit beta OS=Canis lupus familiaris GN=SEC61B PE=1 SV=2 36 109 1.0E-12
sp|Q9CQS8|SC61B_MOUSE Protein transport protein Sec61 subunit beta OS=Mus musculus GN=Sec61b PE=1 SV=3 36 109 4.0E-12
sp|Q54YR4|SC61B_DICDI Protein transport protein Sec61 subunit beta OS=Dictyostelium discoideum GN=sec61b PE=3 SV=1 53 109 3.0E-08
sp|P38389|SC61B_ARATH Protein transport protein Sec61 subunit beta OS=Arabidopsis thaliana GN=At2g45070 PE=1 SV=1 69 107 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 82 104 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4675
MASPRSASPATGQAAASGASVGRPSSPAPPGGARTAIRRRAAADQKEKIANARPTSTRAAGAGGSSSTMLRLYTD
ESPGLKVDPVIVLVLSLVFIFSVVALHIIAKISRRFSS*
Coding >OphauG2|4675
ATGGCTTCTCCTCGCTCAGCATCGCCTGCTACAGGTCAGGCAGCCGCCAGCGGTGCCAGTGTCGGTCGTCCCTCT
TCACCTGCGCCGCCGGGAGGAGCCCGTACCGCGATTCGACGACGGGCTGCAGCCGATCAAAAGGAAAAGATAGCC
AATGCACGGCCAACAAGCACGAGGGCGGCTGGTGCGGGTGGCTCTAGCAGCACTATGCTGAGGCTCTACACGGAC
GAGTCGCCTGGTCTCAAAGTGGATCCCGTCATTGTTCTAGTGCTTTCCTTGGTGTTTATTTTCAGTGTTGTCGCT
CTGCATATCATTGCCAAAATTTCTCGACGCTTCTCTAGCTAG
Transcript >OphauG2|4675
ATGGCTTCTCCTCGCTCAGCATCGCCTGCTACAGGTCAGGCAGCCGCCAGCGGTGCCAGTGTCGGTCGTCCCTCT
TCACCTGCGCCGCCGGGAGGAGCCCGTACCGCGATTCGACGACGGGCTGCAGCCGATCAAAAGGAAAAGATAGCC
AATGCACGGCCAACAAGCACGAGGGCGGCTGGTGCGGGTGGCTCTAGCAGCACTATGCTGAGGCTCTACACGGAC
GAGTCGCCTGGTCTCAAAGTGGATCCCGTCATTGTTCTAGTGCTTTCCTTGGTGTTTATTTTCAGTGTTGTCGCT
CTGCATATCATTGCCAAAATTTCTCGACGCTTCTCTAGCTAG
Gene >OphauG2|4675
ATGGTACGCACAGCTCAGCGCATCCCCGCTTGACACACTCGCTACACCCTTGGATCGGGCACTGTAGCAAGCGCA
TAGACTATATTGACCGTGGTTTACATTCAGGCTTCTCCTCGCTCAGCATCGCCTGCTACAGGTCAGGCAGCCGCC
AGCGGTGCCAGTGTCGGTCGTCCCTCTTCACCTGCGCCGCCGGGAGGAGCCCGTACCGCGATTCGACGACGGGCT
GCAGCCGATCAAAAGGAAAAGATAGCCAATGCACGGCCAACAAGCACGAGGGCGGCTGGTGCGGGTGGCTCTAGC
AGCACTATGCTGAGTAGGTCAAGAGAGGGCGGGATTGAGCTTCAAGGACAGTGAAGCTGACTTGGGCTCATACAG
GGCTCTACACGGACGAGTCGCCTGGTCTCAAAGTGGATCCCGTCATTGTTCTAGTGCTTTCCTTGGTGTTTATTT
TCAGTGTTGTCGCTCTGCATAGTAAGTTGTGCCGATATACTCGACGGTCGTTGCAGCGCTTTGCTTGCTAACACT
TGGCTCAGTCATTGCCAAAATTTCTCGACGCTTCTCTAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail