Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4669
Gene name
LocationContig_4:35171..36337
Strand-
Gene length (bp)1166
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 123 353 4.0E-15
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 51 306 4.0E-14
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 40 306 4.0E-14
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 36 306 2.0E-13
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 51 306 9.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 123 353 4.0E-15
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 51 306 4.0E-14
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 40 306 4.0E-14
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 36 306 2.0E-13
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 51 306 9.0E-13
sp|Q7L211|ABHDD_HUMAN Alpha/beta hydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=2 SV=1 51 306 4.0E-11
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 123 315 3.0E-10
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 123 315 3.0E-10
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 119 254 7.0E-10
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 123 254 8.0E-10
sp|Q08DW9|ABD12_BOVIN Monoacylglycerol lipase ABHD12 OS=Bos taurus GN=ABHD12 PE=2 SV=1 123 254 2.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2027
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4669 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4507
Ophiocordyceps camponoti-floridani Ophcf2|03299
Ophiocordyceps camponoti-rufipedis Ophun1|6175
Ophiocordyceps kimflemingae Ophio5|3538
Ophiocordyceps subramaniannii Hirsu2|2291

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4669
MLKASMRKAPLRKASPVLPLPTPWKRHFHPFLPPLLFTGLVISLYTWKCCMLVVFQSFIIYNPFIPPDSRTVRIA
DFAKQCRDFEWREKRIKASDGTQIALCTNELECAGAASKAHDPTYVYIVYFQGNAASTPYRLPDITSILGIVRDL
GPKAADVYSTICLSYRGYWTSHDRPSERGINLDSMATLAYVERTHDERKAKNPNCKSVLVLWGQSIGSGFVTNLA
ASHPDRPKMKIDALVLETPFTNTRDMLKALYPQRWLPYQYLWPFLRTKLDSYKNMSFIAQLPSHRRPEIHIIEAG
QDELVPRHHATILANHGRDVGLNVEHHCVQKALHNGVMTGNSGRQAIARAIAKAVHDALHRQNGPEK*
Coding >OphauG2|4669
ATGCTCAAGGCTTCTATGCGCAAGGCTCCTCTGCGCAAGGCTTCTCCCGTCTTGCCTCTGCCGACTCCATGGAAG
AGGCACTTTCACCCCTTTCTGCCGCCCCTCCTGTTCACCGGCCTTGTTATCTCGCTTTACACATGGAAGTGTTGC
ATGCTGGTTGTTTTCCAAAGCTTTATCATCTACAATCCATTTATTCCCCCAGACTCCCGCACCGTGCGCATTGCC
GATTTTGCGAAACAATGCCGAGACTTTGAATGGCGTGAAAAGCGCATCAAAGCCAGCGACGGCACTCAGATTGCC
CTCTGTACAAACGAGCTGGAATGCGCTGGGGCCGCTAGCAAAGCGCATGACCCGACGTATGTTTACATTGTCTAC
TTTCAAGGCAATGCGGCGTCTACGCCATACCGACTGCCTGATATTACGTCCATTCTTGGCATCGTGCGAGACCTT
GGACCAAAAGCGGCCGACGTATATAGCACAATCTGTCTAAGCTACCGTGGCTACTGGACGTCGCATGACAGGCCT
TCGGAGCGTGGCATCAATTTGGATTCCATGGCCACACTGGCATATGTTGAACGGACACACGACGAGAGAAAGGCC
AAAAACCCCAACTGCAAGTCTGTTCTGGTGCTTTGGGGACAAAGCATTGGCTCTGGCTTCGTCACGAATCTGGCC
GCCTCGCATCCTGACCGCCCCAAGATGAAAATAGATGCTTTAGTGCTGGAAACGCCCTTTACCAACACACGAGAT
ATGCTCAAGGCCCTGTATCCGCAACGCTGGCTTCCATATCAGTATCTCTGGCCCTTTCTACGCACCAAGCTCGAC
AGCTACAAGAACATGAGTTTCATTGCCCAATTGCCGTCACACAGGCGCCCAGAGATTCATATTATTGAGGCAGGC
CAGGACGAACTTGTGCCACGCCATCACGCCACGATACTTGCCAACCATGGTCGTGATGTGGGTCTCAATGTTGAA
CATCACTGCGTGCAAAAAGCCCTTCATAATGGTGTCATGACGGGGAACAGTGGTAGACAGGCCATTGCCCGCGCC
ATAGCAAAGGCCGTTCATGATGCTCTACATCGTCAGAATGGTCCCGAAAAATAG
Transcript >OphauG2|4669
ATGCTCAAGGCTTCTATGCGCAAGGCTCCTCTGCGCAAGGCTTCTCCCGTCTTGCCTCTGCCGACTCCATGGAAG
AGGCACTTTCACCCCTTTCTGCCGCCCCTCCTGTTCACCGGCCTTGTTATCTCGCTTTACACATGGAAGTGTTGC
ATGCTGGTTGTTTTCCAAAGCTTTATCATCTACAATCCATTTATTCCCCCAGACTCCCGCACCGTGCGCATTGCC
GATTTTGCGAAACAATGCCGAGACTTTGAATGGCGTGAAAAGCGCATCAAAGCCAGCGACGGCACTCAGATTGCC
CTCTGTACAAACGAGCTGGAATGCGCTGGGGCCGCTAGCAAAGCGCATGACCCGACGTATGTTTACATTGTCTAC
TTTCAAGGCAATGCGGCGTCTACGCCATACCGACTGCCTGATATTACGTCCATTCTTGGCATCGTGCGAGACCTT
GGACCAAAAGCGGCCGACGTATATAGCACAATCTGTCTAAGCTACCGTGGCTACTGGACGTCGCATGACAGGCCT
TCGGAGCGTGGCATCAATTTGGATTCCATGGCCACACTGGCATATGTTGAACGGACACACGACGAGAGAAAGGCC
AAAAACCCCAACTGCAAGTCTGTTCTGGTGCTTTGGGGACAAAGCATTGGCTCTGGCTTCGTCACGAATCTGGCC
GCCTCGCATCCTGACCGCCCCAAGATGAAAATAGATGCTTTAGTGCTGGAAACGCCCTTTACCAACACACGAGAT
ATGCTCAAGGCCCTGTATCCGCAACGCTGGCTTCCATATCAGTATCTCTGGCCCTTTCTACGCACCAAGCTCGAC
AGCTACAAGAACATGAGTTTCATTGCCCAATTGCCGTCACACAGGCGCCCAGAGATTCATATTATTGAGGCAGGC
CAGGACGAACTTGTGCCACGCCATCACGCCACGATACTTGCCAACCATGGTCGTGATGTGGGTCTCAATGTTGAA
CATCACTGCGTGCAAAAAGCCCTTCATAATGGTGTCATGACGGGGAACAGTGGTAGACAGGCCATTGCCCGCGCC
ATAGCAAAGGCCGTTCATGATGCTCTACATCGTCAGAATGGTCCCGAAAAATAG
Gene >OphauG2|4669
ATGCTCAAGGCTTCTATGCGCAAGGCTCCTCTGCGCAAGGCTTCTCCCGTCTTGCCTCTGCCGACTCCATGGAAG
AGGCACTTTCACCCCTTTCTGCCGCCCCTCCTGTTCACCGGCCTTGTTATCTCGCTTTACACATGGAAGTGTTGC
ATGCTGGTTGTTTTCCAAAGCTTTATCATCTACAATCCATTTATTCCCCCAGACTCCCGCACCGTGCGCATTGCC
GATTTTGCGAAACAATGCCGAGACTTTGAATGGCGTGAAAAGCGCATCAAAGCCAGCGACGGCACTCAGATTGCC
CTCTGTACAAACGAGCTGGAATGCGCTGGGGCCGCTAGCAAAGCGCATGACCCGACGTATGTTTACATTGTCTAC
TTTCAAGGTGCGTCTTTGGTCTATCGGACCACATCGGATCAAAGCCCATAGCTTGTCAATTAACTGCAGGCAATG
CGGCGTCTACGCCATACCGACTGCCTGATATTACGTCCATTCTTGGCATCGTGCGAGACCTTGGACCAAAAGCGG
CCGACGTATATAGCACAATCTGTCTAAGCTACCGTGGCTACTGGACGTCGCATGACAGGCCTTCGGAGCGTGGCA
TCAATTTGGATTCCATGGCCACACTGGCATATGTTGAACGGACACACGACGAGAGAAAGGCCAAAAACCCCAACT
GCAAGTCTGTTCTGGTGCTTTGGGGACAAAGCATTGGCTCTGGCTTCGTCACGAATCTGGCCGCCTCGCATCCTG
ACCGCCCCAAGATGAAAATAGATGCTTTAGTGCTGGAAACGCCCTTTACCAACACACGAGATATGCTCAAGGCCC
TGTATCCGCAACGCTGGCTTCCATATCAGTATCTCTGGCCCTTTCTACGCACCAAGCTCGACAGCTACAAGAACA
TGAGTTTCATTGCCCAATTGCCGTCACACAGGCGCCCAGAGATTCATATTATTGAGGCAGGCCAGGACGAACTTG
TGCCACGCCATCACGCCACGATACTTGCCAACCATGGTCGTGATGTGGGTCTCAATGTTGAACATCACTGCGTGC
AAAAAGCCCTTCATAATGGTGTCATGACGGGGAACAGTGGTAGACAGGCCATTGCCCGCGCCATAGCAAAGGCCG
TTCATGATGCTCTACATCGTCAGAATGGTCCCGAAAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail