Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4653
Gene name
LocationContig_399:11491..12843
Strand-
Gene length (bp)1352
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06999 Suc_Fer-like Sucrase/ferredoxin-like 4.4E-70 61 324

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38281|APD1_YEAST Actin patches distal protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=APD1 PE=1 SV=1 29 260 4.0E-22
sp|C4Y1G7|AIM32_CLAL4 Altered inheritance of mitochondria protein 32 OS=Clavispora lusitaniae (strain ATCC 42720) GN=AIM32 PE=3 SV=1 132 317 3.0E-11

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5968
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4653 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|951
Ophiocordyceps camponoti-floridani Ophcf2|01266
Ophiocordyceps camponoti-rufipedis Ophun1|800
Ophiocordyceps kimflemingae Ophio5|4880

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4653
MAALKSLMSSVLGHVSSKSPDQGYIFPSTDATRDGQACLLDCESCSVQYPRGFSIDETDELYGGVKGWGTHLVVA
TGKTDWVRDVADEKGSVMAAVEALPKPSNGRIMLSASNMPTPHNSADYTQPTTVLLLPAFTLVHNVAPANAHFLV
DNLVSSAPTTTTPLGPLGLPSTVPSTPALTTAPCPHSAVILMCSQKTRDARCGQSAPLLRKELERHLRPLGLYRD
LHDQRPGGVGIYFISHVGGHKYSANVMVYRRPNAFGQDHVGDEADDDTNVHAPVHGSEADVGAAQCIWLARVKPQ
DCQNLIKYTVLQGKVVKPQSQLRGGFDRSRGLTSW*
Coding >OphauG2|4653
ATGGCGGCGCTCAAATCACTCATGTCATCTGTTCTCGGCCACGTCAGCAGCAAGAGTCCAGACCAAGGCTACATA
TTCCCCAGCACAGATGCAACCCGCGACGGCCAAGCCTGTCTACTTGACTGCGAGTCGTGCTCGGTGCAGTATCCG
CGCGGCTTCTCCATTGACGAGACTGACGAGCTGTACGGCGGAGTCAAGGGCTGGGGCACGCACTTGGTTGTTGCG
ACAGGCAAGACGGACTGGGTGCGCGACGTGGCGGATGAAAAGGGCAGTGTCATGGCGGCGGTGGAAGCACTGCCC
AAACCGAGCAACGGGAGAATCATGCTGTCGGCATCAAACATGCCTACCCCCCACAACAGCGCCGACTACACTCAG
CCCACCACGGTGCTTCTGCTGCCCGCCTTCACCCTGGTTCACAACGTGGCGCCCGCCAATGCCCACTTTCTCGTC
GACAACCTGGTCAGCAGCGCACCCACTACCACGACGCCCCTGGGGCCCTTGGGCCTGCCCTCCACTGTGCCCAGC
ACGCCTGCCCTGACTACAGCTCCCTGTCCACACAGCGCCGTCATCCTCATGTGCAGCCAAAAGACTCGCGATGCC
CGATGCGGCCAGAGTGCCCCCCTGCTGCGCAAAGAGCTTGAGCGCCATCTACGCCCCCTGGGGCTGTACCGTGAT
TTGCATGACCAACGGCCCGGGGGCGTGGGCATCTACTTCATCAGCCATGTTGGAGGGCACAAGTACTCGGCAAAT
GTCATGGTCTACCGGCGGCCCAATGCCTTTGGCCAGGACCATGTTGGTGACGAGGCAGATGACGACACAAATGTA
CATGCACCTGTCCACGGAAGCGAGGCTGATGTAGGCGCCGCGCAGTGCATCTGGCTAGCTAGAGTCAAGCCGCAG
GACTGCCAAAACCTCATCAAGTACACGGTGCTCCAGGGCAAAGTTGTCAAGCCGCAGAGTCAGTTGCGCGGCGGC
TTCGACAGATCCCGAGGGCTCACAAGCTGGTGA
Transcript >OphauG2|4653
ATGGCGGCGCTCAAATCACTCATGTCATCTGTTCTCGGCCACGTCAGCAGCAAGAGTCCAGACCAAGGCTACATA
TTCCCCAGCACAGATGCAACCCGCGACGGCCAAGCCTGTCTACTTGACTGCGAGTCGTGCTCGGTGCAGTATCCG
CGCGGCTTCTCCATTGACGAGACTGACGAGCTGTACGGCGGAGTCAAGGGCTGGGGCACGCACTTGGTTGTTGCG
ACAGGCAAGACGGACTGGGTGCGCGACGTGGCGGATGAAAAGGGCAGTGTCATGGCGGCGGTGGAAGCACTGCCC
AAACCGAGCAACGGGAGAATCATGCTGTCGGCATCAAACATGCCTACCCCCCACAACAGCGCCGACTACACTCAG
CCCACCACGGTGCTTCTGCTGCCCGCCTTCACCCTGGTTCACAACGTGGCGCCCGCCAATGCCCACTTTCTCGTC
GACAACCTGGTCAGCAGCGCACCCACTACCACGACGCCCCTGGGGCCCTTGGGCCTGCCCTCCACTGTGCCCAGC
ACGCCTGCCCTGACTACAGCTCCCTGTCCACACAGCGCCGTCATCCTCATGTGCAGCCAAAAGACTCGCGATGCC
CGATGCGGCCAGAGTGCCCCCCTGCTGCGCAAAGAGCTTGAGCGCCATCTACGCCCCCTGGGGCTGTACCGTGAT
TTGCATGACCAACGGCCCGGGGGCGTGGGCATCTACTTCATCAGCCATGTTGGAGGGCACAAGTACTCGGCAAAT
GTCATGGTCTACCGGCGGCCCAATGCCTTTGGCCAGGACCATGTTGGTGACGAGGCAGATGACGACACAAATGTA
CATGCACCTGTCCACGGAAGCGAGGCTGATGTAGGCGCCGCGCAGTGCATCTGGCTAGCTAGAGTCAAGCCGCAG
GACTGCCAAAACCTCATCAAGTACACGGTGCTCCAGGGCAAAGTTGTCAAGCCGCAGAGTCAGTTGCGCGGCGGC
TTCGACAGATCCCGAGGGCTCACAAGCTGGTGA
Gene >OphauG2|4653
ATGGCGGCGCTCAAATCACTCATGTCATCTGTTCTCGGCCACGTCAGCAGCAAGAGTCCAGACCAAGGCTACATA
TTCCCCAGCACAGATGCAACCCGCGACGGCCAAGCCTGTCTACTTGACTGCGAGTCGTGCTCGGTGCAGTATCCG
CGCGGCTTCTCCATTGACGAGACTGACGAGCTGTACGGCGGAGTCAAGGGCTGGGGCACGCACTTGGTTGTTGCG
ACAGGCAAGACGGACTGGGTGCGCGACGTGGCGGATGAAAAGGGCAGTGTCATGGCGGCGGTGGAAGCACTGCCC
AAACCGAGCAACGGGGTGAGTCACGTTGTTGTTTTTTCTTGCTCCTCCTGGCTGTCGCGGCCATTCTTGTCTCTA
GGACTGCCCTGTTCAAGTGAAGTGGGCGAATGAGCATGAGCATGTTTGCATGAGCTGCTCGTCAAGGATGCCTCC
AAGAGCCTCTTGTGCGAGATGGCTGTACGAAACGCTTGCACGAGATGCTTGCACGAGATGTTGGTGCGAGATGCT
CAATGCTCACATGAGTGGGAGAGTACTCTGTAAGCACGGCACGAGCGCGAGCATGAGGGCGAGCGCATAAAGCCA
AGCACTTTTTTACAGTCCAGACTGCAAAACAAAGGCAGCAGCTAACTCAAGGAACAAAGAGAATCATGCTGTCGG
CATCAAACATGCCTACCCCCCACAACAGCGCCGACTACACTCAGCCCACCACGGTGCTTCTGCTGCCCGCCTTCA
CCCTGGTTCACAACGTGGCGCCCGCCAATGCCCACTTTCTCGTCGACAACCTGGTCAGCAGCGCACCCACTACCA
CGACGCCCCTGGGGCCCTTGGGCCTGCCCTCCACTGTGCCCAGCACGCCTGCCCTGACTACAGCTCCCTGTCCAC
ACAGCGCCGTCATCCTCATGTGCAGCCAAAAGACTCGCGATGCCCGATGCGGCCAGAGTGCCCCCCTGCTGCGCA
AAGAGCTTGAGCGCCATCTACGCCCCCTGGGGCTGTACCGTGATTTGCATGACCAACGGCCCGGGGGCGTGGGCA
TCTACTTCATCAGCCATGTTGGAGGGCACAAGTACTCGGCAAATGTCATGGTCTACCGGCGGCCCAATGCCTTTG
GCCAGGACCATGTTGGTGACGAGGCAGATGACGACACAAATGTACATGCACCTGTCCACGGAAGCGAGGCTGATG
TAGGCGCCGCGCAGTGCATCTGGCTAGCTAGAGTCAAGCCGCAGGACTGCCAAAACCTCATCAAGTACACGGTGC
TCCAGGGCAAAGTTGTCAAGCCGCAGAGTCAGTTGCGCGGCGGCTTCGACAGATCCCGAGGGCTCACAAGCTGGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail