Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4639
Gene name
LocationContig_398:427..1848
Strand+
Gene length (bp)1421
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08438 MMR_HSR1_C GTPase of unknown function C-terminal 3.2E-35 226 345
PF01926 MMR_HSR1 50S ribosome-binding GTPase 8.1E-20 7 127
PF02421 FeoB_N Ferrous iron transport protein B 2.0E-07 7 43

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42942|YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR210C PE=1 SV=1 1 414 0.0E+00
sp|O94362|YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.15 PE=3 SV=1 1 414 1.0E-179
sp|Q58728|Y1332_METJA Uncharacterized GTP-binding protein MJ1332 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1332 PE=3 SV=1 6 412 4.0E-83
sp|P37518|YCHF_BACSU Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) GN=ychF PE=3 SV=1 8 260 1.0E-18
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 7 136 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42942|YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR210C PE=1 SV=1 1 414 0.0E+00
sp|O94362|YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC428.15 PE=3 SV=1 1 414 1.0E-179
sp|Q58728|Y1332_METJA Uncharacterized GTP-binding protein MJ1332 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1332 PE=3 SV=1 6 412 4.0E-83
sp|P37518|YCHF_BACSU Ribosome-binding ATPase YchF OS=Bacillus subtilis (strain 168) GN=ychF PE=3 SV=1 8 260 1.0E-18
sp|B8BBN7|OLA1_ORYSI Obg-like ATPase 1 OS=Oryza sativa subsp. indica GN=OsI_28170 PE=3 SV=1 7 136 5.0E-17
sp|Q6Z1J6|OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica GN=YchF1 PE=1 SV=1 7 136 5.0E-17
sp|Q6AK07|OBG_DESPS GTPase Obg OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=obg PE=3 SV=1 7 131 1.0E-16
sp|Q9SA73|OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana GN=YchF1 PE=1 SV=1 7 122 3.0E-16
sp|B2A6B7|OBG_NATTJ GTPase Obg OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=obg PE=3 SV=1 7 149 1.0E-15
sp|Q7VMI2|YCHF_HAEDU Ribosome-binding ATPase YchF OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ychF PE=3 SV=3 8 144 1.0E-15
sp|P57288|YCHF_BUCAI Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ychF PE=3 SV=3 8 115 2.0E-15
sp|P0ABU4|YCHF_SHIFL Ribosome-binding ATPase YchF OS=Shigella flexneri GN=ychF PE=3 SV=2 8 144 3.0E-15
sp|P0ABU2|YCHF_ECOLI Ribosome-binding ATPase YchF OS=Escherichia coli (strain K12) GN=ychF PE=1 SV=2 8 144 3.0E-15
sp|P0ABU3|YCHF_ECO57 Ribosome-binding ATPase YchF OS=Escherichia coli O157:H7 GN=ychF PE=3 SV=2 8 144 3.0E-15
sp|Q8K9V2|YCHF_BUCAP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ychF PE=3 SV=3 8 145 7.0E-15
sp|A3DBS5|OBG_CLOTH GTPase Obg OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=obg PE=3 SV=1 7 147 1.0E-14
sp|P44681|YCHF_HAEIN Ribosome-binding ATPase YchF OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ychF PE=1 SV=2 8 144 1.0E-14
sp|A4QG78|OBG_CORGB GTPase Obg OS=Corynebacterium glutamicum (strain R) GN=obg PE=3 SV=1 7 155 2.0E-14
sp|P0C1E6|OBG_CORGL GTPase Obg OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=obg PE=3 SV=1 7 155 2.0E-14
sp|Q9CP90|YCHF_PASMU Ribosome-binding ATPase YchF OS=Pasteurella multocida (strain Pm70) GN=ychF PE=3 SV=3 8 115 2.0E-14
sp|A7NRU6|OBG_ROSCS GTPase Obg OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=obg PE=3 SV=2 7 279 3.0E-14
sp|Q8RBA5|OBG_CALS4 GTPase Obg OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=obg PE=3 SV=1 7 147 3.0E-14
sp|Q8FN81|OBG_COREF GTPase Obg OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=obg PE=3 SV=2 7 149 4.0E-14
sp|A0JPJ7|OLA1_RAT Obg-like ATPase 1 OS=Rattus norvegicus GN=Ola1 PE=2 SV=1 7 144 4.0E-14
sp|B0K414|OBG_THEPX GTPase Obg OS=Thermoanaerobacter sp. (strain X514) GN=obg PE=3 SV=1 7 147 6.0E-14
sp|B0KAB8|OBG_THEP3 GTPase Obg OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=obg PE=3 SV=1 7 147 6.0E-14
sp|Q2GGS7|OBG_EHRCR GTPase Obg OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=obg PE=3 SV=1 7 118 8.0E-14
sp|P47270|YCHF_MYCGE Ribosome-binding ATPase YchF OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ychF PE=3 SV=1 8 115 9.0E-14
sp|Q67SC6|OBG_SYMTH GTPase Obg OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=obg PE=3 SV=1 7 147 9.0E-14
sp|Q5R821|OLA1_PONAB Obg-like ATPase 1 OS=Pongo abelii GN=OLA1 PE=2 SV=1 7 144 9.0E-14
sp|Q7ZU42|OLA1_DANRE Obg-like ATPase 1 OS=Danio rerio GN=ola1 PE=2 SV=1 7 144 1.0E-13
sp|B2UQ30|OBG_AKKM8 GTPase Obg OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=obg PE=3 SV=2 8 156 1.0E-13
sp|Q2HJ33|OLA1_BOVIN Obg-like ATPase 1 OS=Bos taurus GN=OLA1 PE=2 SV=1 7 144 1.0E-13
sp|Q6NFV7|OBG_CORDI GTPase Obg OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=obg PE=3 SV=1 7 149 1.0E-13
sp|Q9NTK5|OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens GN=OLA1 PE=1 SV=2 7 144 1.0E-13
sp|A8GQ55|OBG_RICAH GTPase Obg OS=Rickettsia akari (strain Hartford) GN=obg PE=3 SV=1 7 118 1.0E-13
sp|A8GTZ9|OBG_RICRS GTPase Obg OS=Rickettsia rickettsii (strain Sheila Smith) GN=obg PE=3 SV=2 7 118 1.0E-13
sp|B0BVJ1|OBG_RICRO GTPase Obg OS=Rickettsia rickettsii (strain Iowa) GN=obg PE=3 SV=2 7 118 1.0E-13
sp|Q92G19|OBG_RICCN GTPase Obg OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=obg PE=3 SV=2 7 118 1.0E-13
sp|Q9CZ30|OLA1_MOUSE Obg-like ATPase 1 OS=Mus musculus GN=Ola1 PE=1 SV=1 7 144 1.0E-13
sp|Q4UJV1|OBG_RICFE GTPase Obg OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=obg PE=3 SV=1 7 118 1.0E-13
sp|Q1AVU3|OBG_RUBXD GTPase Obg OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=obg PE=3 SV=1 7 127 1.0E-13
sp|A8F2Y3|OBG_RICM5 GTPase Obg OS=Rickettsia massiliae (strain Mtu5) GN=obg PE=3 SV=2 7 118 2.0E-13
sp|A9KMF5|OBG_CLOPH GTPase Obg OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=obg PE=3 SV=1 7 177 2.0E-13
sp|B1I5V8|OBG_DESAP GTPase Obg OS=Desulforudis audaxviator (strain MP104C) GN=obg PE=3 SV=1 7 147 2.0E-13
sp|Q5ZM25|OLA1_CHICK Obg-like ATPase 1 OS=Gallus gallus GN=OLA1 PE=2 SV=1 7 144 2.0E-13
sp|Q21D04|OBG_RHOPB GTPase Obg OS=Rhodopseudomonas palustris (strain BisB18) GN=obg PE=3 SV=1 8 201 2.0E-13
sp|P91917|OLA1_CAEEL Obg-like ATPase 1 OS=Caenorhabditis elegans GN=ola-1 PE=3 SV=1 7 174 2.0E-13
sp|A7IH06|OBG_XANP2 GTPase Obg OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=obg PE=3 SV=1 8 201 3.0E-13
sp|Q3YRX8|OBG_EHRCJ GTPase Obg OS=Ehrlichia canis (strain Jake) GN=obg PE=3 SV=1 7 118 3.0E-13
sp|Q5FH94|OBG_EHRRG GTPase Obg OS=Ehrlichia ruminantium (strain Gardel) GN=obg PE=3 SV=1 7 118 3.0E-13
sp|Q5HB45|OBG_EHRRW GTPase Obg OS=Ehrlichia ruminantium (strain Welgevonden) GN=obg PE=3 SV=1 7 118 3.0E-13
sp|A5D410|OBG_PELTS GTPase Obg OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=obg PE=3 SV=1 7 159 4.0E-13
sp|Q9ZCB6|OBG_RICPR GTPase Obg OS=Rickettsia prowazekii (strain Madrid E) GN=obg PE=3 SV=1 7 129 4.0E-13
sp|B9L101|OBG_THERP GTPase Obg OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=obg PE=3 SV=1 7 147 4.0E-13
sp|A8HS51|OBG_AZOC5 GTPase Obg OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=obg PE=3 SV=1 8 201 5.0E-13
sp|Q5NR23|OBG_ZYMMO GTPase Obg OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=obg PE=3 SV=1 7 119 5.0E-13
sp|B0S3Z4|OBG_FINM2 GTPase Obg OS=Finegoldia magna (strain ATCC 29328) GN=obg PE=3 SV=1 7 147 5.0E-13
sp|B1M697|OBG_METRJ GTPase Obg OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=obg PE=3 SV=1 8 201 5.0E-13
sp|B3QZT1|OBG_PHYMT GTPase Obg OS=Phytoplasma mali (strain AT) GN=obg PE=3 SV=1 7 155 6.0E-13
sp|A4XAG1|OBG_SALTO GTPase Obg OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=obg PE=3 SV=1 7 155 7.0E-13
sp|A1TC21|OBG_MYCVP GTPase Obg OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=obg PE=3 SV=1 7 147 8.0E-13
sp|A4T2J4|OBG_MYCGI GTPase Obg OS=Mycobacterium gilvum (strain PYR-GCK) GN=obg PE=3 SV=1 7 147 9.0E-13
sp|A7HJZ8|OBG_FERNB GTPase Obg OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=obg PE=3 SV=1 7 155 9.0E-13
sp|A5VD74|OBG_SPHWW GTPase Obg OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=obg PE=3 SV=1 8 119 1.0E-12
sp|P38746|YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLF2 PE=1 SV=1 1 145 1.0E-12
sp|P20964|OBG_BACSU GTPase Obg OS=Bacillus subtilis (strain 168) GN=obg PE=1 SV=1 7 147 1.0E-12
sp|Q07U75|OBG_RHOP5 GTPase Obg OS=Rhodopseudomonas palustris (strain BisA53) GN=obg PE=3 SV=1 8 118 1.0E-12
sp|A8F063|OBG_RICCK GTPase Obg OS=Rickettsia canadensis (strain McKiel) GN=obg PE=3 SV=1 7 118 1.0E-12
sp|Q89X89|OBG_BRADU GTPase Obg OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=obg PE=3 SV=1 8 201 1.0E-12
sp|Q89AR6|YCHF_BUCBP Ribosome-binding ATPase YchF OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ychF PE=3 SV=3 8 115 1.0E-12
sp|C0QUB5|OBG_PERMH GTPase Obg OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=obg PE=3 SV=1 7 118 2.0E-12
sp|B1MMY5|OBG_MYCA9 GTPase Obg OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=obg PE=3 SV=1 7 147 2.0E-12
sp|Q65GM7|OBG_BACLD GTPase Obg OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=obg PE=3 SV=1 7 147 2.0E-12
sp|B9DNE7|OBG_STACT GTPase Obg OS=Staphylococcus carnosus (strain TM300) GN=obg PE=3 SV=1 7 159 2.0E-12
sp|A5E965|OBG_BRASB GTPase Obg OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=obg PE=3 SV=1 8 201 2.0E-12
sp|B5ELU2|OBG_ACIF5 GTPase Obg OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=obg PE=3 SV=1 7 208 2.0E-12
sp|B7J427|OBG_ACIF2 GTPase Obg OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=obg PE=3 SV=1 7 208 2.0E-12
sp|B8FM68|OBG_DESAA GTPase Obg OS=Desulfatibacillum alkenivorans (strain AK-01) GN=obg PE=3 SV=1 7 135 2.0E-12
sp|Q6MEQ6|OBG_PARUW GTPase Obg OS=Protochlamydia amoebophila (strain UWE25) GN=obg PE=3 SV=1 7 155 2.0E-12
sp|B8EQH4|OBG_METSB GTPase Obg OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=obg PE=3 SV=1 8 202 2.0E-12
sp|B8I179|OBG_CLOCE GTPase Obg OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=obg PE=3 SV=1 7 183 2.0E-12
sp|P75088|YCHF_MYCPN Ribosome-binding ATPase YchF OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ychF PE=3 SV=1 8 115 2.0E-12
sp|B3CQ33|OBG_ORITI GTPase Obg OS=Orientia tsutsugamushi (strain Ikeda) GN=obg PE=3 SV=1 7 118 3.0E-12
sp|A5CDM6|OBG_ORITB GTPase Obg OS=Orientia tsutsugamushi (strain Boryong) GN=obg PE=3 SV=1 7 118 3.0E-12
sp|Q5Z041|OBG_NOCFA GTPase Obg OS=Nocardia farcinica (strain IFM 10152) GN=obg PE=3 SV=1 7 147 3.0E-12
sp|A0R149|OBG_MYCS2 GTPase Obg OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=obg PE=3 SV=1 7 147 3.0E-12
sp|Q1GHD0|OBG_RUEST GTPase Obg OS=Ruegeria sp. (strain TM1040) GN=obg PE=3 SV=1 8 128 3.0E-12
sp|Q1B629|OBG_MYCSS GTPase Obg OS=Mycobacterium sp. (strain MCS) GN=obg PE=3 SV=1 7 147 3.0E-12
sp|A1UJ07|OBG_MYCSK GTPase Obg OS=Mycobacterium sp. (strain KMS) GN=obg PE=3 SV=1 7 147 3.0E-12
sp|A3Q2F3|OBG_MYCSJ GTPase Obg OS=Mycobacterium sp. (strain JLS) GN=obg PE=3 SV=1 7 147 3.0E-12
sp|A1WY48|OBG_HALHL GTPase Obg OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=obg PE=3 SV=1 7 164 3.0E-12
sp|A8M0Y9|OBG_SALAI GTPase Obg OS=Salinispora arenicola (strain CNS-205) GN=obg PE=3 SV=1 7 155 4.0E-12
sp|Q7CW97|OBG_AGRFC GTPase Obg OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=obg PE=3 SV=2 8 118 4.0E-12
sp|B2HMG1|OBG_MYCMM GTPase Obg OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=obg PE=3 SV=1 7 147 4.0E-12
sp|A4YKF3|OBG_BRASO GTPase Obg OS=Bradyrhizobium sp. (strain ORS278) GN=obg PE=3 SV=1 8 118 4.0E-12
sp|Q2SRV9|OBG_MYCCT GTPase Obg OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=obg PE=3 SV=1 7 188 4.0E-12
sp|B1HVB2|OBG_LYSSC GTPase Obg OS=Lysinibacillus sphaericus (strain C3-41) GN=obg PE=3 SV=2 7 147 4.0E-12
sp|Q2NCX8|OBG_ERYLH GTPase Obg OS=Erythrobacter litoralis (strain HTCC2594) GN=obg PE=3 SV=1 7 128 4.0E-12
sp|Q2J3J8|OBG_RHOP2 GTPase Obg OS=Rhodopseudomonas palustris (strain HaA2) GN=obg PE=3 SV=1 8 118 5.0E-12
sp|B8CXZ0|OBG_HALOH GTPase Obg OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=obg PE=3 SV=1 7 147 5.0E-12
sp|Q9PAS3|OBG_XYLFA GTPase Obg OS=Xylella fastidiosa (strain 9a5c) GN=obg PE=3 SV=2 7 130 5.0E-12
sp|Q8SWU7|OLA1_DROME Obg-like ATPase 1 OS=Drosophila melanogaster GN=CG1354 PE=1 SV=1 7 154 5.0E-12
sp|B0U3R3|OBG_XYLFM GTPase Obg OS=Xylella fastidiosa (strain M12) GN=obg PE=3 SV=1 7 130 5.0E-12
sp|Q8CNZ7|OBG_STAES GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 12228) GN=obg PE=3 SV=1 7 181 6.0E-12
sp|Q5HNQ7|OBG_STAEQ GTPase Obg OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=obg PE=3 SV=1 7 181 6.0E-12
sp|B3Q731|OBG_RHOPT GTPase Obg OS=Rhodopseudomonas palustris (strain TIE-1) GN=obg PE=3 SV=1 8 118 6.0E-12
sp|Q6NDE6|OBG_RHOPA GTPase Obg OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=obg PE=3 SV=1 8 118 6.0E-12
sp|O13998|OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.03c PE=1 SV=1 8 250 6.0E-12
sp|A4J7I9|OBG_DESRM GTPase Obg OS=Desulfotomaculum reducens (strain MI-1) GN=obg PE=3 SV=1 7 196 7.0E-12
sp|Q9KDK0|OBG_BACHD GTPase Obg OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=obg PE=3 SV=1 8 147 7.0E-12
sp|C1F9K2|OBG_ACIC5 GTPase Obg OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=obg PE=3 SV=1 7 175 7.0E-12
sp|A4XJS8|OBG_CALS8 GTPase Obg OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=obg PE=3 SV=2 7 172 7.0E-12
sp|A7Z781|OBG_BACMF GTPase Obg OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=obg PE=3 SV=1 7 147 7.0E-12
sp|Q87BL2|OBG_XYLFT GTPase Obg OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=obg PE=3 SV=1 7 130 7.0E-12
sp|B2I6V6|OBG_XYLF2 GTPase Obg OS=Xylella fastidiosa (strain M23) GN=obg PE=3 SV=1 7 130 7.0E-12
sp|A0QDH0|OBG_MYCA1 GTPase Obg OS=Mycobacterium avium (strain 104) GN=obg PE=3 SV=1 7 147 7.0E-12
sp|B2IE44|OBG_BEII9 GTPase Obg OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=obg PE=3 SV=1 8 202 7.0E-12
sp|Q73XP5|OBG_MYCPA GTPase Obg OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=obg PE=3 SV=1 7 147 7.0E-12
sp|Q3SVI2|OBG_NITWN GTPase Obg OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=obg PE=3 SV=1 8 117 7.0E-12
sp|B9MRB8|OBG_CALBD GTPase Obg OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=obg PE=3 SV=1 7 172 7.0E-12
sp|Q13DL7|OBG_RHOPS GTPase Obg OS=Rhodopseudomonas palustris (strain BisB5) GN=obg PE=3 SV=1 8 118 8.0E-12
sp|A0PU15|OBG_MYCUA GTPase Obg OS=Mycobacterium ulcerans (strain Agy99) GN=obg PE=3 SV=1 7 147 8.0E-12
sp|Q0SH51|OBG_RHOJR GTPase Obg OS=Rhodococcus jostii (strain RHA1) GN=obg PE=3 SV=1 7 147 8.0E-12
sp|Q6AFY1|OBG_LEIXX GTPase Obg OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=obg PE=3 SV=1 7 147 8.0E-12
sp|O67849|OBG_AQUAE GTPase Obg OS=Aquifex aeolicus (strain VF5) GN=obg PE=3 SV=1 7 118 9.0E-12
sp|Q2JDP2|OBG_FRASC GTPase Obg OS=Frankia sp. (strain CcI3) GN=obg PE=3 SV=1 7 155 9.0E-12
sp|Q49Y82|OBG_STAS1 GTPase Obg OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=obg PE=3 SV=1 7 159 1.0E-11
sp|Q1RGV9|OBG_RICBR GTPase Obg OS=Rickettsia bellii (strain RML369-C) GN=obg PE=3 SV=1 7 118 1.0E-11
sp|A8GUG0|OBG_RICB8 GTPase Obg OS=Rickettsia bellii (strain OSU 85-389) GN=obg PE=3 SV=1 7 118 1.0E-11
sp|C3M9X9|OBG_RHISN GTPase Obg OS=Rhizobium sp. (strain NGR234) GN=obg PE=3 SV=1 8 118 1.0E-11
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 7 124 1.0E-11
sp|A6TQJ6|OBG_ALKMQ GTPase Obg OS=Alkaliphilus metalliredigens (strain QYMF) GN=obg PE=3 SV=1 7 147 1.0E-11
sp|Q9CF94|OBG_LACLA GTPase Obg OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=obg PE=3 SV=1 7 147 1.0E-11
sp|Q7ZWM6|OLA1_XENLA Obg-like ATPase 1 OS=Xenopus laevis GN=ola1 PE=2 SV=1 7 144 1.0E-11
sp|Q8RHS8|OBG_FUSNN GTPase Obg OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=obg PE=3 SV=1 7 118 1.0E-11
sp|B6JD21|OBG_OLICO GTPase Obg OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=obg PE=3 SV=1 8 118 1.0E-11
sp|A1IPH6|OBG_NEIMA GTPase Obg OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=obg PE=3 SV=1 7 116 1.0E-11
sp|A1KWG2|OBG_NEIMF GTPase Obg OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=obg PE=3 SV=1 7 116 1.0E-11
sp|B4RQP4|OBG_NEIG2 GTPase Obg OS=Neisseria gonorrhoeae (strain NCCP11945) GN=obg PE=3 SV=1 7 116 1.0E-11
sp|Q5F5D9|OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=obg PE=1 SV=1 7 116 1.0E-11
sp|A9M061|OBG_NEIM0 GTPase Obg OS=Neisseria meningitidis serogroup C (strain 053442) GN=obg PE=3 SV=1 7 116 1.0E-11
sp|B5ZUE3|OBG_RHILW GTPase Obg OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=obg PE=3 SV=1 8 118 1.0E-11
sp|Q9JXE5|OBG_NEIMB GTPase Obg OS=Neisseria meningitidis serogroup B (strain MC58) GN=obg PE=3 SV=1 7 116 1.0E-11
sp|A9IMA6|OBG_BART1 GTPase Obg OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=obg PE=3 SV=1 8 118 1.0E-11
sp|B9JER1|OBG_AGRRK GTPase Obg OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=obg PE=3 SV=1 8 118 1.0E-11
sp|Q022G3|OBG_SOLUE GTPase Obg OS=Solibacter usitatus (strain Ellin6076) GN=obg PE=3 SV=1 7 147 1.0E-11
sp|B7GIR2|OBG_ANOFW GTPase Obg OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|Q0D3S3|OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica GN=OBGC1 PE=3 SV=1 7 119 2.0E-11
sp|A2YPR8|OBGC1_ORYSI Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. indica GN=OBGC1 PE=3 SV=1 7 119 2.0E-11
sp|Q8L7L0|OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana GN=OBGL PE=2 SV=1 7 220 2.0E-11
sp|Q6MTG9|OBG_MYCMS GTPase Obg OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=obg PE=3 SV=1 7 188 2.0E-11
sp|Q5WHS8|OBG_BACSK GTPase Obg OS=Bacillus clausii (strain KSM-K16) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|A2RJQ6|OBG_LACLM GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|Q2K2X6|OBG_RHIEC GTPase Obg OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=obg PE=3 SV=1 8 118 2.0E-11
sp|Q02XY2|OBG_LACLS GTPase Obg OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|P9WMT1|OBG_MYCTU GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=obg PE=1 SV=1 7 147 2.0E-11
sp|A5U5D6|OBG_MYCTA GTPase Obg OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|A1KLD6|OBG_MYCBP GTPase Obg OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|Q7TYK5|OBG_MYCBO GTPase Obg OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|A6LJZ0|OBG_THEM4 GTPase Obg OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=obg PE=3 SV=1 7 155 2.0E-11
sp|P9WMT0|OBG_MYCTO GTPase Obg OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=obg PE=3 SV=1 7 147 2.0E-11
sp|Q0RPF6|OBG_FRAAA GTPase Obg OS=Frankia alni (strain ACN14a) GN=obg PE=3 SV=1 7 155 2.0E-11
sp|A1B9C8|OBG_PARDP GTPase Obg OS=Paracoccus denitrificans (strain Pd 1222) GN=obg PE=3 SV=1 8 135 2.0E-11
sp|A7HT67|OBG_PARL1 GTPase Obg OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=obg PE=3 SV=1 8 124 2.0E-11
sp|A5UZ80|OBG_ROSS1 GTPase Obg OS=Roseiflexus sp. (strain RS-1) GN=obg PE=3 SV=1 7 164 2.0E-11
sp|B1Y280|OBG_LEPCP GTPase Obg OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=obg PE=3 SV=1 7 167 2.0E-11
sp|A8LK09|OBG_DINSH GTPase Obg OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=obg PE=3 SV=1 8 118 2.0E-11
sp|A8L1V6|OBG_FRASN GTPase Obg OS=Frankia sp. (strain EAN1pec) GN=obg PE=3 SV=1 7 149 2.0E-11
sp|A0LSX1|OBG_ACIC1 GTPase Obg OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=obg PE=3 SV=1 7 152 2.0E-11
sp|Q66JG0|OLA1_XENTR Obg-like ATPase 1 OS=Xenopus tropicalis GN=ola1 PE=2 SV=1 7 144 3.0E-11
sp|Q2Y807|OBG_NITMU GTPase Obg OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=obg PE=3 SV=1 7 116 3.0E-11
sp|B0RDG3|OBG_CLAMS GTPase Obg OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=obg PE=3 SV=1 7 147 3.0E-11
sp|B3PRZ3|OBG_RHIE6 GTPase Obg OS=Rhizobium etli (strain CIAT 652) GN=obg PE=3 SV=1 8 118 3.0E-11
sp|B9JUH9|OBG_AGRVS GTPase Obg OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=obg PE=3 SV=1 8 118 3.0E-11
sp|C0ZAL7|OBG_BREBN GTPase Obg OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=obg PE=3 SV=1 7 147 3.0E-11
sp|Q1MA76|OBG_RHIL3 GTPase Obg OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=obg PE=3 SV=1 8 118 3.0E-11
sp|Q5L6R9|OBG_CHLAB GTPase Obg OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=obg PE=3 SV=1 7 147 3.0E-11
sp|A5CR32|OBG_CLAM3 GTPase Obg OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=obg PE=3 SV=1 7 147 3.0E-11
sp|Q2RKZ8|OBG_MOOTA GTPase Obg OS=Moorella thermoacetica (strain ATCC 39073) GN=obg PE=3 SV=1 7 118 3.0E-11
sp|Q9RY66|OBG_DEIRA GTPase Obg OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=obg PE=3 SV=1 7 135 3.0E-11
sp|Q03F34|OBG_PEDPA GTPase Obg OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=obg PE=3 SV=1 7 135 3.0E-11
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 7 147 3.0E-11
sp|B8HU67|OBG_CYAP4 GTPase Obg OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=obg PE=3 SV=1 7 150 3.0E-11
sp|Q5HFB9|OBG_STAAC GTPase Obg OS=Staphylococcus aureus (strain COL) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|B9LC30|OBG_CHLSY GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=obg PE=3 SV=1 7 259 4.0E-11
sp|A9WK62|OBG_CHLAA GTPase Obg OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=obg PE=3 SV=1 7 259 4.0E-11
sp|A4IRC7|OBG_GEOTN GTPase Obg OS=Geobacillus thermodenitrificans (strain NG80-2) GN=obg PE=3 SV=1 7 225 4.0E-11
sp|B3DVG9|OBG_METI4 GTPase Obg OS=Methylacidiphilum infernorum (isolate V4) GN=obg PE=3 SV=2 7 147 4.0E-11
sp|Q2YT86|OBG_STAAB GTPase Obg OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|Q824F3|OBG_CHLCV GTPase Obg OS=Chlamydophila caviae (strain GPIC) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|Q7A0Q3|OBG_STAAW GTPase Obg OS=Staphylococcus aureus (strain MW2) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|A8Z2H2|OBG_STAAT GTPase Obg OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|Q6G8S5|OBG_STAAS GTPase Obg OS=Staphylococcus aureus (strain MSSA476) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|Q7A584|OBG_STAAN GTPase Obg OS=Staphylococcus aureus (strain N315) GN=obg PE=1 SV=1 7 261 4.0E-11
sp|Q99TK9|OBG_STAAM GTPase Obg OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|A6QHI6|OBG_STAAE GTPase Obg OS=Staphylococcus aureus (strain Newman) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|A5ITG8|OBG_STAA9 GTPase Obg OS=Staphylococcus aureus (strain JH9) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|Q2FXT1|OBG_STAA8 GTPase Obg OS=Staphylococcus aureus (strain NCTC 8325) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|Q2FG83|OBG_STAA3 GTPase Obg OS=Staphylococcus aureus (strain USA300) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|A6U2B2|OBG_STAA2 GTPase Obg OS=Staphylococcus aureus (strain JH1) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|A7X361|OBG_STAA1 GTPase Obg OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=obg PE=3 SV=1 7 261 4.0E-11
sp|B2TK70|OBG_CLOBB GTPase Obg OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|B2V0A8|OBG_CLOBA GTPase Obg OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|C0MDB4|OBG_STRS7 GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|Q4L6Y9|OBG_STAHJ GTPase Obg OS=Staphylococcus haemolyticus (strain JCSC1435) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|Q5KWP5|OBG_GEOKA GTPase Obg OS=Geobacillus kaustophilus (strain HTA426) GN=obg PE=3 SV=1 7 225 4.0E-11
sp|A6WDM9|OBG_KINRD GTPase Obg OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=obg PE=3 SV=1 7 147 4.0E-11
sp|Q0BRE9|OBG_GRABC GTPase Obg OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=obg PE=3 SV=2 8 118 4.0E-11
sp|Q4FP46|OBG_PELUB GTPase Obg OS=Pelagibacter ubique (strain HTCC1062) GN=obg PE=3 SV=1 7 118 5.0E-11
sp|Q5LRY4|OBG_RUEPO GTPase Obg OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=obg PE=3 SV=1 7 118 5.0E-11
sp|Q6GG60|OBG_STAAR GTPase Obg OS=Staphylococcus aureus (strain MRSA252) GN=obg PE=3 SV=1 7 147 5.0E-11
sp|Q1WT46|OBG_LACS1 GTPase Obg OS=Lactobacillus salivarius (strain UCC118) GN=obg PE=3 SV=1 7 147 5.0E-11
sp|B8GA36|OBG_CHLAD GTPase Obg OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=obg PE=3 SV=1 7 196 5.0E-11
sp|A4F9L3|OBG_SACEN GTPase Obg OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=obg PE=3 SV=1 8 165 6.0E-11
sp|Q892N8|OBG_CLOTE GTPase Obg OS=Clostridium tetani (strain Massachusetts / E88) GN=obg PE=3 SV=1 7 147 6.0E-11
sp|B2V968|OBG_SULSY GTPase Obg OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=obg PE=3 SV=1 7 118 6.0E-11
sp|Q6MGS5|OBG_BDEBA GTPase Obg OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=obg PE=3 SV=2 7 151 6.0E-11
sp|A6LQR9|OBG_CLOB8 GTPase Obg OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=obg PE=3 SV=1 7 147 6.0E-11
sp|B5YJ65|OBG_THEYD GTPase Obg OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=obg PE=3 SV=1 7 147 7.0E-11
sp|Q9I7M2|GTPBA_DROME GTP-binding protein 10 homolog OS=Drosophila melanogaster GN=CG10628 PE=2 SV=2 7 135 7.0E-11
sp|Q6A9H8|OBG_PROAC GTPase Obg OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=obg PE=3 SV=1 7 146 7.0E-11
sp|Q8EPQ0|OBG_OCEIH GTPase Obg OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=obg PE=3 SV=1 7 147 7.0E-11
sp|B2KAW2|OBG_ELUMP GTPase Obg OS=Elusimicrobium minutum (strain Pei191) GN=obg PE=3 SV=1 7 128 7.0E-11
sp|A8FFS8|OBG_BACP2 GTPase Obg OS=Bacillus pumilus (strain SAFR-032) GN=obg PE=3 SV=1 7 147 7.0E-11
sp|B3PMC1|OBG_MYCA5 GTPase Obg OS=Mycoplasma arthritidis (strain 158L3-1) GN=obg PE=3 SV=1 7 214 7.0E-11
sp|Q29K06|GTPBA_DROPS GTP-binding protein 10 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA10450 PE=3 SV=1 7 135 7.0E-11
sp|B2GGD9|OBG_KOCRD GTPase Obg OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=obg PE=3 SV=1 7 147 7.0E-11
sp|B9L605|OBG_NAUPA GTPase Obg OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=obg PE=3 SV=1 7 122 8.0E-11
sp|A1AT81|OBG_PELPD GTPase Obg OS=Pelobacter propionicus (strain DSM 2379) GN=obg PE=3 SV=1 7 118 8.0E-11
sp|Q5SHE9|OBG_THET8 GTPase Obg OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=obg PE=1 SV=1 7 154 8.0E-11
sp|B8IEL9|OBG_METNO GTPase Obg OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=obg PE=3 SV=1 8 118 9.0E-11
sp|Q72HR4|OBG_THET2 GTPase Obg OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=obg PE=3 SV=1 7 154 9.0E-11
sp|B0TBW1|OBG_HELMI GTPase Obg OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=obg PE=3 SV=1 7 147 9.0E-11
sp|Q253F8|OBG_CHLFF GTPase Obg OS=Chlamydophila felis (strain Fe/C-56) GN=obg PE=3 SV=1 7 119 9.0E-11
sp|C0MBS1|OBG_STRE4 GTPase Obg OS=Streptococcus equi subsp. equi (strain 4047) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|B4U3Q7|OBG_STREM GTPase Obg OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|Q1IVS5|OBG_KORVE GTPase Obg OS=Koribacter versatilis (strain Ellin345) GN=obg PE=3 SV=1 7 175 1.0E-10
sp|Q6G0S8|OBG_BARQU GTPase Obg OS=Bartonella quintana (strain Toulouse) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|B1YJR9|OBG_EXIS2 GTPase Obg OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=obg PE=3 SV=1 7 172 1.0E-10
sp|A9FJF8|OBG_SORC5 GTPase Obg OS=Sorangium cellulosum (strain So ce56) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 7 118 1.0E-10
sp|A6WXS0|OBG_OCHA4 GTPase Obg OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 7 118 1.0E-10
sp|Q8FYM2|OBG_BRUSU GTPase Obg OS=Brucella suis biovar 1 (strain 1330) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|A9WWW9|OBG_BRUSI GTPase Obg OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|A5VSI5|OBG_BRUO2 GTPase Obg OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=obg PE=3 SV=2 8 118 1.0E-10
sp|Q8YJ80|OBG_BRUME GTPase Obg OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=obg PE=3 SV=2 8 118 1.0E-10
sp|A9M882|OBG_BRUC2 GTPase Obg OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|Q57B45|OBG_BRUAB GTPase Obg OS=Brucella abortus biovar 1 (strain 9-941) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|Q2YLM2|OBG_BRUA2 GTPase Obg OS=Brucella abortus (strain 2308) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|B2S806|OBG_BRUA1 GTPase Obg OS=Brucella abortus (strain S19) GN=obg PE=3 SV=1 8 118 1.0E-10
sp|Q2GDW7|OBG_NEOSM GTPase Obg OS=Neorickettsia sennetsu (strain Miyayama) GN=obg PE=3 SV=1 7 118 1.0E-10
sp|Q9CNS4|OBG_PASMU GTPase Obg OS=Pasteurella multocida (strain Pm70) GN=obg PE=3 SV=1 7 147 1.0E-10
sp|Q6DHF7|GTPBA_DANRE GTP-binding protein 10 OS=Danio rerio GN=gtpbp10 PE=2 SV=1 7 119 2.0E-10
sp|F4HSD4|OBGM_ARATH Probable GTP-binding protein OBGM, mitochondrial OS=Arabidopsis thaliana GN=ATOBGM PE=2 SV=1 7 125 2.0E-10
sp|O14078|YEAD_SCHPO Obg-like ATPase homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E11.13c PE=3 SV=1 7 145 2.0E-10
sp|A4WZ45|OBG_RHOS5 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=obg PE=3 SV=2 8 120 2.0E-10
sp|A6UDV6|OBG_SINMW GTPase Obg OS=Sinorhizobium medicae (strain WSM419) GN=obg PE=3 SV=1 8 118 2.0E-10
sp|Q82C85|OBG_STRAW GTPase Obg OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=obg PE=3 SV=1 7 150 2.0E-10
sp|Q7NZS1|OBG_CHRVO GTPase Obg OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=obg PE=3 SV=1 7 136 2.0E-10
sp|B9KW04|OBG_RHOSK GTPase Obg OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=obg PE=3 SV=1 8 120 2.0E-10
sp|Q0AHG5|OBG_NITEC GTPase Obg OS=Nitrosomonas eutropha (strain C91) GN=obg PE=3 SV=1 7 118 2.0E-10
sp|A0JXJ8|OBG_ARTS2 GTPase Obg OS=Arthrobacter sp. (strain FB24) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|A0ZZZ0|OBG_BIFAA GTPase Obg OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q3IXX9|OBG_RHOS4 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=obg PE=3 SV=1 8 120 2.0E-10
sp|A3PQJ0|OBG_RHOS1 GTPase Obg OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=obg PE=3 SV=1 8 120 2.0E-10
sp|Q2GK25|OBG_ANAPZ GTPase Obg OS=Anaplasma phagocytophilum (strain HZ) GN=obg PE=3 SV=1 7 118 2.0E-10
sp|Q92LB4|OBG_RHIME GTPase Obg OS=Rhizobium meliloti (strain 1021) GN=obg PE=3 SV=2 8 118 2.0E-10
sp|Q1GZ53|OBG_METFK GTPase Obg OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=obg PE=3 SV=1 7 116 2.0E-10
sp|Q28Q12|OBG_JANSC GTPase Obg OS=Jannaschia sp. (strain CCS1) GN=obg PE=3 SV=2 7 118 2.0E-10
sp|Q9Z808|OBG_CHLPN GTPase Obg OS=Chlamydia pneumoniae GN=obg PE=3 SV=1 7 118 2.0E-10
sp|P0CB41|OBG_CAUCR GTPase Obg OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=obg PE=3 SV=1 7 118 2.0E-10
sp|B8GYI7|OBG_CAUCN GTPase Obg/CgtA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cgtA PE=1 SV=1 7 118 2.0E-10
sp|Q9UT06|YLWB_SCHPO Uncharacterized GTP-binding protein P8A3.11c, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP8A3.11c PE=3 SV=1 7 116 2.0E-10
sp|Q03JJ8|OBG_STRTD GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q5M3C8|OBG_STRT2 GTPase Obg OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q5LYR4|OBG_STRT1 GTPase Obg OS=Streptococcus thermophilus (strain CNRZ 1066) GN=obg PE=3 SV=1 7 147 2.0E-10
sp|Q2G983|OBG_NOVAD GTPase Obg OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=obg PE=3 SV=2 8 122 2.0E-10
sp|Q6F0U3|OBG_MESFL GTPase Obg OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|Q3AF51|OBG_CARHZ GTPase Obg OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|B1H0I4|OBG_UNCTG GTPase Obg OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=obg PE=3 SV=1 7 147 3.0E-10
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 8 118 3.0E-10
sp|A8ZRY1|OBG_DESOH GTPase Obg OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=obg PE=3 SV=1 7 118 3.0E-10
sp|Q0I1P5|OBG_HAES1 GTPase Obg OS=Haemophilus somnus (strain 129Pt) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|A5CX17|OBG_VESOH GTPase Obg OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=obg PE=3 SV=1 7 116 3.0E-10
sp|B0UVI2|OBG_HISS2 GTPase Obg OS=Histophilus somni (strain 2336) GN=obg PE=3 SV=1 7 147 3.0E-10
sp|A5GD29|OBG_GEOUR GTPase Obg OS=Geobacter uraniireducens (strain Rf4) GN=obg PE=3 SV=1 7 122 3.0E-10
sp|A1KAD0|OBG_AZOSB GTPase Obg OS=Azoarcus sp. (strain BH72) GN=obg PE=3 SV=1 7 136 3.0E-10
sp|B3WE52|OBG_LACCB GTPase Obg OS=Lactobacillus casei (strain BL23) GN=obg PE=3 SV=1 7 169 3.0E-10
sp|Q039J3|OBG_LACC3 GTPase Obg OS=Lactobacillus casei (strain ATCC 334) GN=obg PE=3 SV=1 7 169 3.0E-10
sp|P95758|OBG_STRGR GTPase Obg OS=Streptomyces griseus GN=obg PE=1 SV=1 7 144 3.0E-10
sp|B1VXD8|OBG_STRGG GTPase Obg OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=obg PE=3 SV=1 7 144 3.0E-10
sp|B0UMS4|OBG_METS4 GTPase Obg OS=Methylobacterium sp. (strain 4-46) GN=obg PE=3 SV=1 8 118 3.0E-10
sp|Q0SR54|OBG_CLOPS GTPase Obg OS=Clostridium perfringens (strain SM101 / Type A) GN=obg PE=3 SV=1 7 119 3.0E-10
sp|Q8XIJ2|OBG_CLOPE GTPase Obg OS=Clostridium perfringens (strain 13 / Type A) GN=obg PE=3 SV=1 7 119 3.0E-10
sp|Q0TNI5|OBG_CLOP1 GTPase Obg OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=obg PE=3 SV=1 7 119 3.0E-10
sp|Q98EZ3|OBG_RHILO GTPase Obg OS=Rhizobium loti (strain MAFF303099) GN=obg PE=3 SV=1 8 118 3.0E-10
sp|B1N057|OBG_LEUCK GTPase Obg OS=Leuconostoc citreum (strain KM20) GN=obg PE=3 SV=2 7 119 4.0E-10
sp|Q18B27|OBG_PEPD6 GTPase Obg OS=Peptoclostridium difficile (strain 630) GN=obg PE=3 SV=1 7 159 4.0E-10
sp|Q6G4Z2|OBG_BARHE GTPase Obg OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=obg PE=3 SV=1 8 118 4.0E-10
sp|Q2RV04|OBG_RHORT GTPase Obg OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=obg PE=3 SV=1 8 118 4.0E-10
sp|Q2IH84|OBG_ANADE GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|Q6F9D8|OBG_ACIAD GTPase Obg OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=obg PE=3 SV=1 7 116 4.0E-10
sp|B7IGK8|OBG_THEAB GTPase Obg OS=Thermosipho africanus (strain TCF52B) GN=obg PE=3 SV=1 7 155 4.0E-10
sp|Q65S59|OBG_MANSM GTPase Obg OS=Mannheimia succiniciproducens (strain MBEL55E) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|Q5GTG3|OBG_WOLTR GTPase Obg OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=obg PE=3 SV=1 7 118 4.0E-10
sp|B8JBP2|OBG_ANAD2 GTPase Obg OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=obg PE=3 SV=1 7 159 4.0E-10
sp|A1R787|OBG_ARTAT GTPase Obg OS=Arthrobacter aurescens (strain TC1) GN=obg PE=3 SV=1 7 144 4.0E-10
sp|P0DB53|OBG_STRPQ GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|P0DB52|OBG_STRP3 GTPase Obg OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|Q47MV6|OBG_THEFY GTPase Obg OS=Thermobifida fusca (strain YX) GN=obg PE=3 SV=1 7 147 4.0E-10
sp|Q3SKG2|OBG_THIDA GTPase Obg OS=Thiobacillus denitrificans (strain ATCC 25259) GN=obg PE=3 SV=1 7 118 4.0E-10
sp|Q48SX8|OBG_STRPM GTPase Obg OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|A9WUU2|OBG_RENSM GTPase Obg OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|B4UIU2|OBG_ANASK GTPase Obg OS=Anaeromyxobacter sp. (strain K) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|B5XLZ0|OBG_STRPZ GTPase Obg OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q5XBM1|OBG_STRP6 GTPase Obg OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q1JGD5|OBG_STRPD GTPase Obg OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q8P0I6|OBG_STRP8 GTPase Obg OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|P95722|OBG_STRCO GTPase Obg OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=obg PE=1 SV=1 7 147 5.0E-10
sp|Q1JLA1|OBG_STRPC GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q1JBB7|OBG_STRPB GTPase Obg OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|Q03YT6|OBG_LEUMM GTPase Obg OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=obg PE=3 SV=1 7 119 5.0E-10
sp|Q99Z94|OBG_STRP1 GTPase Obg OS=Streptococcus pyogenes serotype M1 GN=obg PE=3 SV=1 7 147 5.0E-10
sp|B1YSU7|OBG_BURA4 GTPase Obg OS=Burkholderia ambifaria (strain MC40-6) GN=obg PE=3 SV=1 7 161 5.0E-10
sp|B0VCR5|OBG_ACIBY GTPase Obg OS=Acinetobacter baumannii (strain AYE) GN=obg PE=3 SV=1 7 116 5.0E-10
sp|A3M7M2|OBG_ACIBT GTPase Obg OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=obg PE=3 SV=2 7 116 5.0E-10
sp|B2HWM9|OBG_ACIBC GTPase Obg OS=Acinetobacter baumannii (strain ACICU) GN=obg PE=3 SV=1 7 116 5.0E-10
sp|B7I557|OBG_ACIB5 GTPase Obg OS=Acinetobacter baumannii (strain AB0057) GN=obg PE=3 SV=1 7 116 5.0E-10
sp|B7GYV1|OBG_ACIB3 GTPase Obg OS=Acinetobacter baumannii (strain AB307-0294) GN=obg PE=3 SV=1 7 116 5.0E-10
sp|Q1J652|OBG_STRPF GTPase Obg OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|B0VTQ1|OBG_ACIBS GTPase Obg OS=Acinetobacter baumannii (strain SDF) GN=obg PE=3 SV=1 7 116 5.0E-10
sp|A2RE30|OBG_STRPG GTPase Obg OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=obg PE=3 SV=1 7 147 5.0E-10
sp|A4JBB8|OBG_BURVG GTPase Obg OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=obg PE=3 SV=1 7 161 6.0E-10
sp|Q65ZZ3|OBG_BORBP GTPase Obg OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=obg PE=3 SV=1 7 118 6.0E-10
sp|Q8DGG4|OBG_THEEB GTPase Obg OS=Thermosynechococcus elongatus (strain BP-1) GN=obg PE=3 SV=1 7 181 6.0E-10
sp|Q0AWJ4|OBG_SYNWW GTPase Obg OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=obg PE=3 SV=1 7 120 7.0E-10
sp|A3QB95|OBG_SHELP GTPase Obg OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=obg PE=3 SV=1 7 116 7.0E-10
sp|B9DSH7|OBG_STRU0 GTPase Obg OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=obg PE=3 SV=1 7 155 7.0E-10
sp|Q7VZX6|OBG_BORPE GTPase Obg OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=obg PE=3 SV=1 7 135 7.0E-10
sp|Q7W1P2|OBG_BORPA GTPase Obg OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=obg PE=3 SV=1 7 135 7.0E-10
sp|Q7WQL8|OBG_BORBR GTPase Obg OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=obg PE=3 SV=1 7 135 7.0E-10
sp|A0AIY6|OBG_LISW6 GTPase Obg OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=obg PE=3 SV=1 7 120 7.0E-10
sp|Q7VDW9|OBG_PROMA GTPase Obg OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=obg PE=3 SV=1 7 147 8.0E-10
sp|Q8Y6Z3|OBG_LISMO GTPase Obg OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=obg PE=3 SV=1 7 120 8.0E-10
sp|Q71ZD3|OBG_LISMF GTPase Obg OS=Listeria monocytogenes serotype 4b (strain F2365) GN=obg PE=3 SV=1 7 120 8.0E-10
sp|B2UCV3|OBG_RALPJ GTPase Obg OS=Ralstonia pickettii (strain 12J) GN=obg PE=3 SV=1 7 116 8.0E-10
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 8 117 8.0E-10
sp|B8DHL1|OBG_LISMH GTPase Obg OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=obg PE=3 SV=1 7 120 9.0E-10
sp|Q92BH7|OBG_LISIN GTPase Obg OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=obg PE=3 SV=1 7 120 9.0E-10
sp|B8E0B2|OBG_DICTD GTPase Obg OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=obg PE=3 SV=1 7 122 9.0E-10
sp|B8H9P2|OBG_ARTCA GTPase Obg OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=obg PE=3 SV=1 7 147 9.0E-10
sp|Q3BW46|OBG_XANC5 GTPase Obg OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=obg PE=3 SV=1 7 126 9.0E-10
sp|A4SVA3|OBG_POLSQ GTPase Obg OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=obg PE=3 SV=1 7 116 9.0E-10
sp|B1XT35|OBG_POLNS GTPase Obg OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=obg PE=3 SV=1 7 144 1.0E-09
sp|Q47AD0|OBG_DECAR GTPase Obg OS=Dechloromonas aromatica (strain RCB) GN=obg PE=3 SV=1 7 167 1.0E-09
sp|Q0SM73|OBG_BORAP GTPase Obg OS=Borrelia afzelii (strain PKo) GN=obg PE=3 SV=1 7 118 1.0E-09
sp|B5YEQ1|OBG_DICT6 GTPase Obg OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=obg PE=3 SV=1 7 121 1.0E-09
sp|A8FRU4|OBG_SHESH GTPase Obg OS=Shewanella sediminis (strain HAW-EB3) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|Q2VZU2|OBG_MAGSA GTPase Obg OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=obg PE=3 SV=1 8 118 1.0E-09
sp|A4VUC8|OBG_STRSY GTPase Obg OS=Streptococcus suis (strain 05ZYH33) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|A4W0M2|OBG_STRS2 GTPase Obg OS=Streptococcus suis (strain 98HAH33) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|B3R898|OBG_CUPTR GTPase Obg OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|Q0BIH8|OBG_BURCM GTPase Obg OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=obg PE=3 SV=1 7 161 1.0E-09
sp|Q89AE7|OBG_BUCBP GTPase Obg OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=obg PE=3 SV=1 7 118 1.0E-09
sp|Q5P7Z4|OBG_AROAE GTPase Obg OS=Aromatoleum aromaticum (strain EbN1) GN=obg PE=3 SV=1 7 161 1.0E-09
sp|Q1IW72|OBG_DEIGD GTPase Obg OS=Deinococcus geothermalis (strain DSM 11300) GN=obg PE=3 SV=1 7 135 1.0E-09
sp|Q7UVH6|OBG_RHOBA GTPase Obg OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=obg PE=3 SV=2 7 147 1.0E-09
sp|Q8DPV8|OBG_STRR6 GTPase Obg OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q04KK7|OBG_STRP2 GTPase Obg OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q0K6P6|OBG_CUPNH GTPase Obg OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|A2BUJ6|OBG_PROM5 GTPase Obg OS=Prochlorococcus marinus (strain MIT 9515) GN=obg PE=3 SV=1 7 117 1.0E-09
sp|B9K736|OBG_THENN GTPase Obg OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=obg PE=3 SV=1 7 155 1.0E-09
sp|Q8DUU2|OBG_STRMU GTPase Obg OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=obg PE=3 SV=1 7 155 1.0E-09
sp|B2IQ29|OBG_STRPS GTPase Obg OS=Streptococcus pneumoniae (strain CGSP14) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|B1KGH1|OBG_SHEWM GTPase Obg OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|A0LPF9|OBG_SYNFM GTPase Obg OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=obg PE=3 SV=1 7 118 1.0E-09
sp|B8ZPS8|OBG_STRPJ GTPase Obg OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q97QW8|OBG_STRPN GTPase Obg OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|B5E4J4|OBG_STRP4 GTPase Obg OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|A8AWM9|OBG_STRGC GTPase Obg OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|A8F478|OBG_PSELT GTPase Obg OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=obg PE=3 SV=1 8 132 1.0E-09
sp|B1ZZ37|OBG_OPITP GTPase Obg OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=obg PE=3 SV=1 7 144 1.0E-09
sp|B9E021|OBG_CLOK1 GTPase Obg OS=Clostridium kluyveri (strain NBRC 12016) GN=obg PE=3 SV=2 7 153 1.0E-09
sp|Q8XVL0|OBG_RALSO GTPase Obg OS=Ralstonia solanacearum (strain GMI1000) GN=obg PE=3 SV=1 7 116 1.0E-09
sp|Q97JL4|OBG_CLOAB GTPase Obg OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q8PN23|OBG_XANAC GTPase Obg OS=Xanthomonas axonopodis pv. citri (strain 306) GN=obg PE=3 SV=1 7 126 1.0E-09
sp|B1IBL9|OBG_STRPI GTPase Obg OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=obg PE=3 SV=1 7 147 1.0E-09
sp|Q30XW0|OBG_DESAG GTPase Obg OS=Desulfovibrio alaskensis (strain G20) GN=obg PE=3 SV=2 8 115 1.0E-09
sp|C0QX49|OBG_BRAHW GTPase Obg OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|Q82V20|OBG_NITEU GTPase Obg OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|A0K4B0|OBG_BURCH GTPase Obg OS=Burkholderia cenocepacia (strain HI2424) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|B1JVA1|OBG_BURCC GTPase Obg OS=Burkholderia cenocepacia (strain MC0-3) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|Q39JU7|OBG_BURL3 GTPase Obg OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=obg PE=3 SV=1 7 162 2.0E-09
sp|Q46X17|OBG_CUPPJ GTPase Obg OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|Q4QM31|OBG_HAEI8 GTPase Obg OS=Haemophilus influenzae (strain 86-028NP) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|B2G6R9|OBG_LACRJ GTPase Obg OS=Lactobacillus reuteri (strain JCM 1112) GN=obg PE=3 SV=1 7 177 2.0E-09
sp|A5VJ99|OBG_LACRD GTPase Obg OS=Lactobacillus reuteri (strain DSM 20016) GN=obg PE=3 SV=1 7 177 2.0E-09
sp|B9M3W3|OBG_GEODF GTPase Obg OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=obg PE=3 SV=1 7 122 2.0E-09
sp|Q8DYL0|OBG_STRA5 GTPase Obg OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q8E465|OBG_STRA3 GTPase Obg OS=Streptococcus agalactiae serotype III (strain NEM316) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q3K046|OBG_STRA1 GTPase Obg OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|B4E5X0|OBG_BURCJ GTPase Obg OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|Q1BZE0|OBG_BURCA GTPase Obg OS=Burkholderia cenocepacia (strain AU 1054) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|A9AI60|OBG_BURM1 GTPase Obg OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|Q1LIQ0|OBG_CUPMC GTPase Obg OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|A5UDJ7|OBG_HAEIE GTPase Obg OS=Haemophilus influenzae (strain PittEE) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|A4SR17|OBG_AERS4 GTPase Obg OS=Aeromonas salmonicida (strain A449) GN=obg PE=3 SV=1 7 128 2.0E-09
sp|A5UI23|OBG_HAEIG GTPase Obg OS=Haemophilus influenzae (strain PittGG) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q834V4|OBG_ENTFA GTPase Obg OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=obg PE=3 SV=1 7 146 2.0E-09
sp|Q9CBZ4|OBG_MYCLE GTPase Obg OS=Mycobacterium leprae (strain TN) GN=obg PE=3 SV=1 7 137 2.0E-09
sp|B8ZRN3|OBG_MYCLB GTPase Obg OS=Mycobacterium leprae (strain Br4923) GN=obg PE=3 SV=1 7 137 2.0E-09
sp|Q8G4U0|OBG_BIFLO GTPase Obg OS=Bifidobacterium longum (strain NCC 2705) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|A1URN4|OBG_BARBK GTPase Obg OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=obg PE=3 SV=1 8 115 2.0E-09
sp|P38219|OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OLA1 PE=1 SV=1 8 144 2.0E-09
sp|Q15PF0|OBG_PSEA6 GTPase Obg OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=obg PE=3 SV=1 7 116 2.0E-09
sp|A0Q1T4|OBG_CLONN GTPase Obg OS=Clostridium novyi (strain NT) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|B7GNK1|OBG_BIFLS GTPase Obg OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=obg PE=3 SV=1 7 147 2.0E-09
sp|Q8PBH0|OBG_XANCP GTPase Obg OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|B0RY32|OBG_XANCB GTPase Obg OS=Xanthomonas campestris pv. campestris (strain B100) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|Q4US36|OBG_XANC8 GTPase Obg OS=Xanthomonas campestris pv. campestris (strain 8004) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|Q5H2E5|OBG_XANOR GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|B2STC0|OBG_XANOP GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|Q2P5B4|OBG_XANOM GTPase Obg OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=obg PE=3 SV=1 7 118 2.0E-09
sp|Q2L062|OBG_BORA1 GTPase Obg OS=Bordetella avium (strain 197N) GN=obg PE=3 SV=1 7 162 2.0E-09
sp|Q88VG4|OBG_LACPL GTPase Obg OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=obg PE=3 SV=1 7 172 2.0E-09
sp|Q89ZI9|OBG_BACTN GTPase Obg OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=obg PE=3 SV=1 7 117 3.0E-09
sp|Q21M07|OBG_SACD2 GTPase Obg OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|Q2JS78|OBG_SYNJA GTPase Obg OS=Synechococcus sp. (strain JA-3-3Ab) GN=obg PE=3 SV=1 7 150 3.0E-09
sp|B3ER55|OBG_AMOA5 GTPase Obg OS=Amoebophilus asiaticus (strain 5a2) GN=obg PE=3 SV=1 7 122 3.0E-09
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 8 147 3.0E-09
sp|Q3J6S0|OBG_NITOC GTPase Obg OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|Q2S9T3|OBG_HAHCH GTPase Obg OS=Hahella chejuensis (strain KCTC 2396) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|A1VF56|OBG_DESVV GTPase Obg OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=obg PE=3 SV=1 8 132 3.0E-09
sp|Q72DK0|OBG_DESVH GTPase Obg OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=obg PE=3 SV=1 8 132 3.0E-09
sp|Q73HQ3|OBG_WOLPM GTPase Obg OS=Wolbachia pipientis wMel GN=obg PE=3 SV=1 7 118 3.0E-09
sp|P44915|OBG_HAEIN GTPase Obg OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=obg PE=3 SV=1 7 147 3.0E-09
sp|A4WEZ6|OBG_ENT38 GTPase Obg OS=Enterobacter sp. (strain 638) GN=obg PE=3 SV=1 7 116 3.0E-09
sp|A0KGS9|OBG_AERHH GTPase Obg OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=obg PE=3 SV=1 7 116 3.0E-09
sp|C0R5N5|OBG_WOLWR GTPase Obg OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|Q7V368|OBG_PROMP GTPase Obg OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=obg PE=3 SV=1 7 117 3.0E-09
sp|B8F871|OBG_HAEPS GTPase Obg OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=obg PE=3 SV=1 7 147 3.0E-09
sp|Q2JJ90|OBG_SYNJB GTPase Obg OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=obg PE=3 SV=1 7 150 3.0E-09
sp|A1SMB4|OBG_NOCSJ GTPase Obg OS=Nocardioides sp. (strain BAA-499 / JS614) GN=obg PE=3 SV=1 7 118 3.0E-09
sp|B8J4L3|OBG_DESDA GTPase Obg OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=obg PE=3 SV=1 8 115 3.0E-09
sp|Q8K9G1|OBG_BUCAP GTPase Obg OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=obg PE=3 SV=1 7 120 4.0E-09
sp|Q04EZ8|OBG_OENOB GTPase Obg OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=obg PE=3 SV=1 7 135 4.0E-09
sp|B1X580|OBG_PAUCH Putative GTPase Obg OS=Paulinella chromatophora GN=obg PE=3 SV=1 7 118 4.0E-09
sp|Q2QZ37|OBGM_ORYSJ Probable GTP-binding protein OBGM, mitochondrial OS=Oryza sativa subsp. japonica GN=OBGM PE=2 SV=1 7 123 4.0E-09
sp|A6LD68|OBG_PARD8 GTPase Obg OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=obg PE=3 SV=1 7 119 4.0E-09
sp|Q1DC95|OBG_MYXXD GTPase Obg OS=Myxococcus xanthus (strain DK 1622) GN=obg PE=3 SV=1 7 147 4.0E-09
sp|Q7VP37|OBG_HAEDU GTPase Obg OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=obg PE=3 SV=1 7 147 4.0E-09
sp|B8DVU1|OBG_BIFA0 GTPase Obg OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=obg PE=3 SV=1 7 144 4.0E-09
sp|A1TYY4|OBG_MARHV GTPase Obg OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=obg PE=3 SV=1 7 118 4.0E-09
sp|Q0VSE6|OBG_ALCBS GTPase Obg OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=obg PE=3 SV=1 7 116 4.0E-09
sp|Q1MQQ1|OBG_LAWIP GTPase Obg OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=obg PE=3 SV=1 8 118 5.0E-09
sp|Q9H4K7|MTG2_HUMAN Mitochondrial ribosome-associated GTPase 2 OS=Homo sapiens GN=MTG2 PE=1 SV=1 8 118 5.0E-09
sp|A6L100|OBG_BACV8 GTPase Obg OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=obg PE=3 SV=1 7 115 5.0E-09
sp|Q03QP2|OBG_LACBA GTPase Obg OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=obg PE=3 SV=1 7 135 5.0E-09
sp|A7HIF8|OBG_ANADF GTPase Obg OS=Anaeromyxobacter sp. (strain Fw109-5) GN=obg PE=3 SV=1 7 147 5.0E-09
sp|Q1R6F4|OBG_ECOUT GTPase Obg OS=Escherichia coli (strain UTI89 / UPEC) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|P42641|OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) GN=obgE PE=1 SV=1 7 116 5.0E-09
sp|B1XHF9|OBG_ECODH GTPase Obg OS=Escherichia coli (strain K12 / DH10B) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|Q8FD82|OBG_ECOL6 GTPase Obg OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|Q0TCS7|OBG_ECOL5 GTPase Obg OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|A1AG86|OBG_ECOK1 GTPase Obg OS=Escherichia coli O1:K1 / APEC GN=obg PE=3 SV=1 7 116 5.0E-09
sp|B5YS72|OBG_ECO5E GTPase Obg OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|Q8X9K7|OBG_ECO57 GTPase Obg OS=Escherichia coli O157:H7 GN=obg PE=3 SV=1 7 116 5.0E-09
sp|B7MBV2|OBG_ECO45 GTPase Obg OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|Q5RDW1|MTG2_PONAB Mitochondrial ribosome-associated GTPase 2 OS=Pongo abelii GN=MTG2 PE=2 SV=1 8 118 5.0E-09
sp|A6TEK2|OBG_KLEP7 GTPase Obg OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|A6GZB7|OBG_FLAPJ GTPase Obg OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=obg PE=3 SV=1 7 135 5.0E-09
sp|B5XSV8|OBG_KLEP3 GTPase Obg OS=Klebsiella pneumoniae (strain 342) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|Q7MW55|OBG_PORGI GTPase Obg OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=obg PE=3 SV=1 7 117 5.0E-09
sp|B2RIY7|OBG_PORG3 GTPase Obg OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=obg PE=3 SV=1 7 117 5.0E-09
sp|A7MJF1|OBG_CROS8 GTPase Obg OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|A8AQ74|OBG_CITK8 GTPase Obg OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=obg PE=3 SV=1 7 116 5.0E-09
sp|B1VAF2|OBG_PHYAS GTPase Obg OS=Phytoplasma australiense GN=obg PE=3 SV=1 7 149 6.0E-09
sp|A9IFF9|OBG_BORPD GTPase Obg OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=obg PE=3 SV=1 7 135 6.0E-09
sp|B0BRJ9|OBG_ACTPJ GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=obg PE=3 SV=1 7 147 6.0E-09
sp|B3GZN0|OBG_ACTP7 GTPase Obg OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=obg PE=3 SV=1 7 147 6.0E-09
sp|Q83Q14|OBG_SHIFL GTPase Obg OS=Shigella flexneri GN=obg PE=3 SV=1 7 116 6.0E-09
sp|Q0T0A1|OBG_SHIF8 GTPase Obg OS=Shigella flexneri serotype 5b (strain 8401) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|Q31W60|OBG_SHIBS GTPase Obg OS=Shigella boydii serotype 4 (strain Sb227) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B2U1Z4|OBG_SHIB3 GTPase Obg OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7LR50|OBG_ESCF3 GTPase Obg OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B1LFT3|OBG_ECOSM GTPase Obg OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B6I1Q6|OBG_ECOSE GTPase Obg OS=Escherichia coli (strain SE11) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7NDG7|OBG_ECOLU GTPase Obg OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B1IQU0|OBG_ECOLC GTPase Obg OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|A8A4Z8|OBG_ECOHS GTPase Obg OS=Escherichia coli O9:H4 (strain HS) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7M089|OBG_ECO8A GTPase Obg OS=Escherichia coli O8 (strain IAI1) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7N0W5|OBG_ECO81 GTPase Obg OS=Escherichia coli O81 (strain ED1a) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7LHP6|OBG_ECO55 GTPase Obg OS=Escherichia coli (strain 55989 / EAEC) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7UJ76|OBG_ECO27 GTPase Obg OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|A7ZS79|OBG_ECO24 GTPase Obg OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|Q32BF0|OBG_SHIDS GTPase Obg OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|Q7MYX6|OBG_PHOLL GTPase Obg OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=obg PE=3 SV=1 7 116 6.0E-09
sp|B7NKQ0|OBG_ECO7I GTPase Obg OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=obg PE=3 SV=1 7 116 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4276
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4639 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7238
Ophiocordyceps camponoti-floridani Ophcf2|00721
Ophiocordyceps camponoti-rufipedis Ophun1|2684
Ophiocordyceps kimflemingae Ophio5|6203
Ophiocordyceps subramaniannii Hirsu2|8739

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4639
MPRDPLIGLVGKPSAGKSTTLNSLTDASSKVGNFPFTTIDPQRAVGYLQIDCVCARYGVQDRCKPNHGSCVDGRR
SVPIEMLDVAGLVPGAHQGRGLGNKFLDDLRHADALIHVVDASGTVDAEGKETRGYDPSVDIAWLRSEIVAWISG
NLLQRWPSVRRRHAAIKAAAPDTLQGQFSGYGATASVIARTLHRAAVKEPLEDWSDETVHHIVRCFVDEKFPTVI
ALNKIDHPDADKNIAKIAKTHDANTIVLCSAISEIFLRKMAKQGYINYVEGSEFVDTKQDLIQQGDPTGGGLKDL
DEKNRTRIENLKDMVLYRFGSTGVVQVLSRAAQLLGLVPVFPVRNTSTFSAGASESKFVFRDCVLVRKGSTVGDV
ARKVMGDAPIAYIEGVGNLRVAEDDAVAVGKNDVLSFKIGRT*
Coding >OphauG2|4639
ATGCCGCGCGACCCCCTCATCGGGCTCGTGGGCAAGCCGTCGGCCGGCAAAAGCACCACGCTCAACAGCCTGACG
GACGCCTCGTCAAAAGTTGGCAACTTCCCCTTCACCACAATCGACCCCCAGCGAGCCGTGGGCTACCTCCAGATA
GACTGTGTCTGCGCGCGCTACGGCGTCCAAGACCGCTGCAAACCAAACCATGGCTCGTGCGTCGACGGGCGCCGC
TCCGTTCCCATCGAGATGCTCGATGTTGCTGGACTCGTGCCTGGCGCTCATCAGGGCCGCGGCCTGGGCAACAAG
TTCCTCGACGACCTGCGCCATGCCGATGCCCTCATCCACGTCGTCGACGCCTCGGGCACTGTCGATGCCGAGGGC
AAGGAGACGCGGGGCTACGATCCCTCGGTCGACATTGCTTGGCTGCGCAGCGAAATCGTTGCCTGGATATCCGGC
AATCTGCTCCAGCGCTGGCCCTCGGTTCGTCGCCGCCATGCTGCCATCAAGGCTGCCGCCCCAGATACCCTGCAG
GGCCAGTTCTCCGGCTACGGCGCCACCGCCTCCGTCATTGCTCGCACCCTCCATCGTGCTGCTGTCAAGGAGCCT
CTCGAGGACTGGTCCGACGAAACCGTCCACCACATTGTCCGCTGCTTCGTCGACGAAAAGTTCCCCACCGTCATT
GCCCTCAACAAAATCGACCACCCCGACGCCGACAAGAACATTGCCAAGATTGCCAAGACGCACGATGCCAATACC
ATTGTTCTCTGCTCCGCCATTTCAGAAATCTTCTTGCGCAAAATGGCCAAGCAGGGCTACATCAACTACGTCGAG
GGCAGCGAATTCGTCGACACTAAACAAGACTTGATCCAGCAGGGAGATCCTACCGGAGGCGGTCTCAAGGATCTC
GACGAAAAGAACCGCACCCGCATCGAAAATCTCAAGGACATGGTGCTCTACCGCTTCGGCTCCACAGGCGTCGTC
CAAGTCTTGTCCCGCGCCGCCCAGCTGCTCGGCCTCGTCCCCGTCTTCCCCGTCCGCAACACTTCTACCTTTAGC
GCCGGCGCCTCCGAGTCCAAGTTTGTCTTCCGTGACTGTGTCTTGGTCAGAAAAGGCTCCACTGTTGGCGATGTT
GCCCGTAAAGTCATGGGCGATGCCCCCATAGCATATATTGAGGGCGTCGGAAACCTCAGGGTGGCCGAAGATGAT
GCCGTTGCCGTTGGCAAAAATGATGTGCTGTCCTTCAAAATCGGCCGCACATAG
Transcript >OphauG2|4639
ATGCCGCGCGACCCCCTCATCGGGCTCGTGGGCAAGCCGTCGGCCGGCAAAAGCACCACGCTCAACAGCCTGACG
GACGCCTCGTCAAAAGTTGGCAACTTCCCCTTCACCACAATCGACCCCCAGCGAGCCGTGGGCTACCTCCAGATA
GACTGTGTCTGCGCGCGCTACGGCGTCCAAGACCGCTGCAAACCAAACCATGGCTCGTGCGTCGACGGGCGCCGC
TCCGTTCCCATCGAGATGCTCGATGTTGCTGGACTCGTGCCTGGCGCTCATCAGGGCCGCGGCCTGGGCAACAAG
TTCCTCGACGACCTGCGCCATGCCGATGCCCTCATCCACGTCGTCGACGCCTCGGGCACTGTCGATGCCGAGGGC
AAGGAGACGCGGGGCTACGATCCCTCGGTCGACATTGCTTGGCTGCGCAGCGAAATCGTTGCCTGGATATCCGGC
AATCTGCTCCAGCGCTGGCCCTCGGTTCGTCGCCGCCATGCTGCCATCAAGGCTGCCGCCCCAGATACCCTGCAG
GGCCAGTTCTCCGGCTACGGCGCCACCGCCTCCGTCATTGCTCGCACCCTCCATCGTGCTGCTGTCAAGGAGCCT
CTCGAGGACTGGTCCGACGAAACCGTCCACCACATTGTCCGCTGCTTCGTCGACGAAAAGTTCCCCACCGTCATT
GCCCTCAACAAAATCGACCACCCCGACGCCGACAAGAACATTGCCAAGATTGCCAAGACGCACGATGCCAATACC
ATTGTTCTCTGCTCCGCCATTTCAGAAATCTTCTTGCGCAAAATGGCCAAGCAGGGCTACATCAACTACGTCGAG
GGCAGCGAATTCGTCGACACTAAACAAGACTTGATCCAGCAGGGAGATCCTACCGGAGGCGGTCTCAAGGATCTC
GACGAAAAGAACCGCACCCGCATCGAAAATCTCAAGGACATGGTGCTCTACCGCTTCGGCTCCACAGGCGTCGTC
CAAGTCTTGTCCCGCGCCGCCCAGCTGCTCGGCCTCGTCCCCGTCTTCCCCGTCCGCAACACTTCTACCTTTAGC
GCCGGCGCCTCCGAGTCCAAGTTTGTCTTCCGTGACTGTGTCTTGGTCAGAAAAGGCTCCACTGTTGGCGATGTT
GCCCGTAAAGTCATGGGCGATGCCCCCATAGCATATATTGAGGGCGTCGGAAACCTCAGGGTGGCCGAAGATGAT
GCCGTTGCCGTTGGCAAAAATGATGTGCTGTCCTTCAAAATCGGCCGCACATAG
Gene >OphauG2|4639
ATGCCGCGCGACCCCCTCATCGGGCTCGTGGGCAAGCCGTCGGCCGGCAAAAGCACCACGCTCAACAGCCTGACG
GACGCCTCGTCAAAAGTTGGTCCGTGGCCTGTCTGCGTCGACTACATGGCATGACGCTGACTGCGCGCACCCAGG
CAACTTCCCGTGCGTCTCCTCGCACGCGCCGTGACCTTGGCCGGGTAAATGACTGACGCTCGACAACTCCAGCTT
CACCACAATCGACCCCCAGCGAGCCGTGGGCTACCTCCAGATAGACTGTGTCTGCGCGCGCTACGGCGTCCAAGA
CCGCTGCAAACCAAACCATGGCTCGTGCGTCGACGGGCGCCGCTCCGTTCCCATCGAGATGCTCGATGTTGCTGG
ACTCGTGCCTGGCGCTCATCAGGGCCGCGGCCTGGGCAACAAGTTCCTCGACGACCTGCGCCATGCCGATGCCCT
CATCCACGTCGTCGACGCCTCGGGCACTGTCGATGCCGAGGGCAAGGAGACGCGGGGCTACGATCCCTCGGTCGA
CATTGCTTGGCTGCGCAGCGAAATCGTTGCCTGGATATCCGGCAATCTGCTCCAGCGCTGGCCCTCGGTTCGTCG
CCGCCATGCTGCCATCAAGGCTGCCGCCCCAGATACCCTGCAGGGCCAGTTCTCCGGCTACGGCGCCACCGCCTC
CGTCATTGCTCGCACCCTCCATCGTGCTGCTGTCAAGGAGCCTCTCGAGGACTGGTCCGACGAAACCGTCCACCA
CATTGTCCGCTGCTTCGTCGACGAAAAGTTCCCCACCGTCATTGCCCTCAACAAAATCGACCACCCCGACGCCGA
CAAGAACATTGCCAAGATTGCCAAGACGCACGATGCCAATACCATTGTTCTCTGCTCCGCCATTTCAGAAATCTT
CTTGCGCAAAATGGCCAAGCAGGGCTACATCAACTACGTCGAGGGCAGCGAATTCGTCGACACTAAACAAGACTT
GATCCAGCAGGGAGATCCTACCGGAGGCGGTCTCAAGGATCTCGACGAAAAGAACCGCACCCGCATCGAAAATCT
CAAGGACATGGTGCTCTACCGCTTCGGCTCCACAGGCGTCGTCCAAGTCTTGTCCCGCGCCGCCCAGCTGCTCGG
CCTCGTCCCCGTCTTCCCCGTCCGCAACACTTCTACCTTTAGCGCCGGCGCCTCCGAGTCCAAGTTTGTCTTCCG
TGACTGTGTCTTGGTCAGAAAAGGCTCCACTGTTGGCGATGTTGCCCGTAAAGTCATGGGCGATGCCCCCATAGC
ATATATTGAGGGCGTCGGAAACCTCAGGGTGGCCGAAGATGATGCCGTTGCCGTTGGCAAAAATGATGTGAGCCA
ATCCCCTTTCTGCTATTGCATTCGCTACTCACCTCTACCAGGTGCTGTCCTTCAAAATCGGCCGCACATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail