Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4638
Gene name
LocationContig_397:14769..16197
Strand+
Gene length (bp)1428
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08325 WLM WLM domain 1.0E-25 20 186
PF01863 YgjP-like YgjP-like, metallopeptidase domain 3.2E-06 91 126

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7B5|WSS1_SCHPO DNA-dependent metalloprotease WSS1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.02 PE=3 SV=1 14 251 1.0E-32

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4638
MPLGIERLNSKKSQPNPNIVFIKALAGKTEKAAQGFLERIAAQCVPIMRQHGIYVMSLEEYEPNGEFVGRNFNAG
EVIQLVLKSPQTGRWLPHDYVQMVMMHELAHCKQMNHSGAFWAVRNAYAADMYKLWHQGYTGDGIWGRGANLGTG
EWERNVAHVDEVAGHEVCGGTFRSRSSKRRRRAVLSYQERKQRRIAKKFGTKGMALGADDETKSKLEKGKRIQAK
PRVASSARGRELRAAAALARAEQQKETEAAAAAAAISSEGTSEGEGDEGEGDSASGSDYGEDEAFDASSDVTVTD
AVDVNGKRLLDRRGRGMVKVCGDETGNDVEVKKELDEVRDLLVRGEERRGKQGRLGGKGETGSSGTENKARPQAS
NKVKRESWSQQQHSMACWACSFVNSGAALTCAMCANVLAPDKATGSWRCQRATCRAASYANSADCGVCGLCGQPA
IASPSF*
Coding >OphauG2|4638
ATGCCTCTGGGTATCGAGCGGCTCAATTCGAAAAAATCGCAGCCAAACCCCAACATTGTCTTCATCAAGGCACTG
GCCGGAAAGACGGAAAAGGCAGCCCAAGGGTTTCTGGAGCGAATAGCGGCACAATGCGTTCCCATTATGCGACAG
CACGGCATCTACGTCATGTCTCTTGAGGAATACGAGCCCAATGGCGAGTTTGTCGGGAGAAACTTCAATGCGGGT
GAAGTGATTCAGCTTGTGCTCAAGTCGCCACAGACGGGGCGCTGGCTGCCGCATGACTATGTGCAAATGGTGATG
ATGCACGAGCTGGCGCATTGCAAGCAAATGAATCACTCGGGCGCCTTTTGGGCCGTGCGGAATGCATATGCAGCC
GACATGTATAAGCTTTGGCACCAAGGGTATACGGGCGACGGTATATGGGGCCGCGGTGCCAATCTGGGGACAGGA
GAATGGGAGCGCAATGTGGCACATGTGGACGAAGTTGCCGGGCATGAGGTGTGTGGGGGCACCTTTCGGTCGAGG
AGTAGCAAGAGAAGGCGGCGGGCGGTGCTTTCATATCAGGAAAGAAAGCAGAGGAGAATAGCCAAAAAGTTTGGG
ACAAAGGGCATGGCGCTGGGGGCCGATGACGAGACCAAGAGCAAGCTGGAAAAGGGCAAGAGGATACAGGCCAAG
CCTCGAGTGGCAAGCAGTGCTCGGGGTCGTGAGCTGCGAGCTGCAGCAGCACTGGCGCGGGCTGAGCAGCAAAAG
GAAACAGAGGCGGCGGCGGCGGCGGCGGCTATATCAAGTGAGGGGACAAGCGAGGGCGAAGGTGATGAGGGCGAG
GGCGACAGCGCCAGTGGAAGCGACTACGGGGAAGACGAGGCCTTTGACGCGTCATCGGATGTGACAGTGACAGAC
GCCGTCGACGTCAATGGAAAGCGTCTATTGGACCGCCGGGGGCGAGGCATGGTCAAAGTTTGCGGGGATGAAACA
GGCAATGACGTCGAGGTGAAGAAGGAGCTGGATGAGGTGCGAGATTTGTTGGTGAGGGGAGAGGAGAGGAGAGGC
AAACAAGGGCGGCTTGGGGGCAAGGGCGAAACGGGCAGCTCGGGGACGGAGAACAAAGCCAGGCCCCAAGCCAGC
AACAAAGTCAAGCGGGAGTCATGGTCACAGCAGCAGCATAGCATGGCGTGTTGGGCATGTTCCTTTGTCAACAGC
GGAGCGGCCTTGACATGCGCCATGTGCGCCAATGTGCTGGCACCGGACAAGGCGACAGGAAGCTGGCGGTGCCAG
CGGGCGACGTGCCGGGCAGCCAGCTACGCCAACTCGGCAGACTGCGGCGTATGCGGGCTCTGCGGGCAGCCAGCC
ATTGCAAGTCCGTCCTTTTGA
Transcript >OphauG2|4638
ATGCCTCTGGGTATCGAGCGGCTCAATTCGAAAAAATCGCAGCCAAACCCCAACATTGTCTTCATCAAGGCACTG
GCCGGAAAGACGGAAAAGGCAGCCCAAGGGTTTCTGGAGCGAATAGCGGCACAATGCGTTCCCATTATGCGACAG
CACGGCATCTACGTCATGTCTCTTGAGGAATACGAGCCCAATGGCGAGTTTGTCGGGAGAAACTTCAATGCGGGT
GAAGTGATTCAGCTTGTGCTCAAGTCGCCACAGACGGGGCGCTGGCTGCCGCATGACTATGTGCAAATGGTGATG
ATGCACGAGCTGGCGCATTGCAAGCAAATGAATCACTCGGGCGCCTTTTGGGCCGTGCGGAATGCATATGCAGCC
GACATGTATAAGCTTTGGCACCAAGGGTATACGGGCGACGGTATATGGGGCCGCGGTGCCAATCTGGGGACAGGA
GAATGGGAGCGCAATGTGGCACATGTGGACGAAGTTGCCGGGCATGAGGTGTGTGGGGGCACCTTTCGGTCGAGG
AGTAGCAAGAGAAGGCGGCGGGCGGTGCTTTCATATCAGGAAAGAAAGCAGAGGAGAATAGCCAAAAAGTTTGGG
ACAAAGGGCATGGCGCTGGGGGCCGATGACGAGACCAAGAGCAAGCTGGAAAAGGGCAAGAGGATACAGGCCAAG
CCTCGAGTGGCAAGCAGTGCTCGGGGTCGTGAGCTGCGAGCTGCAGCAGCACTGGCGCGGGCTGAGCAGCAAAAG
GAAACAGAGGCGGCGGCGGCGGCGGCGGCTATATCAAGTGAGGGGACAAGCGAGGGCGAAGGTGATGAGGGCGAG
GGCGACAGCGCCAGTGGAAGCGACTACGGGGAAGACGAGGCCTTTGACGCGTCATCGGATGTGACAGTGACAGAC
GCCGTCGACGTCAATGGAAAGCGTCTATTGGACCGCCGGGGGCGAGGCATGGTCAAAGTTTGCGGGGATGAAACA
GGCAATGACGTCGAGGTGAAGAAGGAGCTGGATGAGGTGCGAGATTTGTTGGTGAGGGGAGAGGAGAGGAGAGGC
AAACAAGGGCGGCTTGGGGGCAAGGGCGAAACGGGCAGCTCGGGGACGGAGAACAAAGCCAGGCCCCAAGCCAGC
AACAAAGTCAAGCGGGAGTCATGGTCACAGCAGCAGCATAGCATGGCGTGTTGGGCATGTTCCTTTGTCAACAGC
GGAGCGGCCTTGACATGCGCCATGTGCGCCAATGTGCTGGCACCGGACAAGGCGACAGGAAGCTGGCGGTGCCAG
CGGGCGACGTGCCGGGCAGCCAGCTACGCCAACTCGGCAGACTGCGGCGTATGCGGGCTCTGCGGGCAGCCAGCC
ATTGCAAGTCCGTCCTTTTGA
Gene >OphauG2|4638
ATGCCTCTGGGTATCGAGCGGCTCAATTCGAAAAAATCGCAGCCAAACCCCAACATTGTCTTCATCAAGGCACTG
GCCGGAAAGACGGAAAAGGCAGCCCAAGGGTTTCTGGAGCGAATAGCGGCACAATGCGGTGAGTATGCGAGATTC
TGCAGCAGGCACGGGGCGGGACTGACAGACAGAGGCAAAGTTCCCATTATGCGACAGCACGGCATCTACGTCATG
TCTCTTGAGGAATACGAGCCCAATGGCGAGTTTGTCGGGAGAAACTTCAATGCGGGTGAAGTGATTCAGCTTGTG
CTCAAGTCGCCACAGACGGGGCGCTGGCTGCCGCATGACTATGTGCAAATGGTGATGATGCACGAGCTGGCGCAT
TGCAAGCAAATGAATCACTCGGGCGCCTTTTGGGCCGTGCGGAATGCATATGCAGCCGACATGTATAAGCTTTGG
CACCAAGGGTATACGGGCGACGGTATATGGGGCCGCGGTGCCAATCTGGGGACAGGAGAATGGGAGCGCAATGTG
GCACATGTGGACGAAGTTGCCGGGCATGAGGTGTGTGGGGGCACCTTTCGGTCGAGGAGTAGCAAGAGAAGGCGG
CGGGCGGTGCTTTCATATCAGGAAAGAAAGCAGAGGAGAATAGCCAAAAAGTTTGGGACAAAGGGCATGGCGCTG
GGGGCCGATGACGAGACCAAGAGCAAGCTGGAAAAGGGCAAGAGGATACAGGCCAAGCCTCGAGTGGCAAGCAGT
GCTCGGGGTCGTGAGCTGCGAGCTGCAGCAGCACTGGCGCGGGCTGAGCAGCAAAAGGAAACAGAGGCGGCGGCG
GCGGCGGCGGCTATATCAAGTGAGGGGACAAGCGAGGGCGAAGGTGATGAGGGCGAGGGCGACAGCGCCAGTGGA
AGCGACTACGGGGAAGACGAGGCCTTTGACGCGTCATCGGATGTGACAGTGACAGACGCCGTCGACGTCAATGGA
AAGCGTCTATTGGACCGCCGGGGGCGAGGCATGGTCAAAGTTTGCGGGGATGAAACAGGCAATGACGTCGAGGTG
AAGAAGGAGCTGGATGAGGTGCGAGATTTGTTGGTGAGGGGAGAGGAGAGGAGAGGCAAACAAGGGCGGCTTGGG
GGCAAGGGCGAAACGGGCAGCTCGGGGACGGAGAACAAAGCCAGGCCCCAAGCCAGCAACAAAGTCAAGCGGGAG
TCATGGTCACAGCAGCAGCATAGCATGGCGTGTTGGGCATGTTCCTTTGTCAACAGCGGAGCGGCCTTGACATGC
GCCATGTGCGCCAATGTGCTGGCACCGGACAAGGCGACAGGAAGCTGGCGGTGCCAGCGGGCGACGTGCCGGGCA
GCCAGCTACGCCAACTCGGCAGACTGCGGCGTATGCGGGCTCTGCGGGCAGCCAGCCATTGCAAGTCCGTCCTTT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail