Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4616
Gene name
LocationContig_394:93..1961
Strand+
Gene length (bp)1868
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00709 Adenylsucc_synt Adenylosuccinate synthetase 7.8E-173 5 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H9E8|PURA_CHAGB Adenylosuccinate synthetase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_03156 PE=3 SV=1 1 422 0.0E+00
sp|A4QXV8|PURA_MAGO7 Adenylosuccinate synthetase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_17000 PE=3 SV=2 1 423 0.0E+00
sp|Q7S604|PURA_NEUCR Adenylosuccinate synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09789 PE=3 SV=1 1 423 0.0E+00
sp|D1ZRH0|PURA_SORMK Adenylosuccinate synthetase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_09309 PE=3 SV=1 1 423 0.0E+00
sp|B2AWF0|PURA_PODAN Adenylosuccinate synthetase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_7_6930 PE=3 SV=1 3 422 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2H9E8|PURA_CHAGB Adenylosuccinate synthetase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_03156 PE=3 SV=1 1 422 0.0E+00
sp|A4QXV8|PURA_MAGO7 Adenylosuccinate synthetase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_17000 PE=3 SV=2 1 423 0.0E+00
sp|Q7S604|PURA_NEUCR Adenylosuccinate synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU09789 PE=3 SV=1 1 423 0.0E+00
sp|D1ZRH0|PURA_SORMK Adenylosuccinate synthetase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_09309 PE=3 SV=1 1 423 0.0E+00
sp|B2AWF0|PURA_PODAN Adenylosuccinate synthetase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_7_6930 PE=3 SV=1 3 422 0.0E+00
sp|C4JYB4|PURA_UNCRE Adenylosuccinate synthetase OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07165 PE=3 SV=1 1 423 0.0E+00
sp|A1D1M2|PURA_NEOFI Adenylosuccinate synthetase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_009950 PE=3 SV=1 3 423 0.0E+00
sp|B6GWE7|PURA_PENRW Adenylosuccinate synthetase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc06g01770 PE=3 SV=1 1 423 0.0E+00
sp|Q0CM45|PURA_ASPTN Adenylosuccinate synthetase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_05239 PE=3 SV=1 3 423 0.0E+00
sp|C5FC83|PURA_ARTOC Adenylosuccinate synthetase OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_00394 PE=3 SV=1 1 423 0.0E+00
sp|Q2UQQ2|PURA_ASPOR Adenylosuccinate synthetase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090005001150 PE=3 SV=1 3 423 0.0E+00
sp|B8MZA3|PURA_ASPFN Adenylosuccinate synthetase OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_083920 PE=3 SV=1 3 423 0.0E+00
sp|B2VXY5|PURA_PYRTR Adenylosuccinate synthetase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_03373 PE=3 SV=1 3 423 1.0E-179
sp|B8M3A8|PURA_TALSN Adenylosuccinate synthetase OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_095260 PE=3 SV=1 1 423 2.0E-179
sp|Q4WRQ7|PURA_ASPFU Adenylosuccinate synthetase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G15450 PE=3 SV=1 3 423 6.0E-179
sp|B0XNF8|PURA_ASPFC Adenylosuccinate synthetase OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_015000 PE=3 SV=1 3 423 6.0E-179
sp|C5PAD0|PURA_COCP7 Adenylosuccinate synthetase OS=Coccidioides posadasii (strain C735) GN=CPC735_008660 PE=3 SV=1 1 423 2.0E-178
sp|Q02787|PURA_SCHPO Adenylosuccinate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade2 PE=1 SV=2 3 423 1.0E-177
sp|A2QB52|PURA_ASPNC Adenylosuccinate synthetase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An01g13920 PE=3 SV=1 3 423 2.0E-177
sp|B6QB86|PURA_TALMQ Adenylosuccinate synthetase OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_074670 PE=3 SV=1 1 423 2.0E-177
sp|A1CNR3|PURA_ASPCL Adenylosuccinate synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_019890 PE=3 SV=1 3 423 2.0E-177
sp|Q0TXG3|PURA_PHANO Adenylosuccinate synthetase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_15719 PE=3 SV=1 3 423 1.0E-176
sp|Q5BEY7|PURA_EMENI Adenylosuccinate synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=adB PE=3 SV=1 3 423 5.0E-176
sp|P0CH97|PURA_CANAW Adenylosuccinate synthetase OS=Candida albicans (strain WO-1) GN=ADE12 PE=3 SV=1 1 421 6.0E-176
sp|P0CH96|PURA_CANAL Adenylosuccinate synthetase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADE12 PE=3 SV=1 1 421 6.0E-176
sp|B9W8Y2|PURA_CANDC Adenylosuccinate synthetase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=CD36_09080 PE=3 SV=1 1 421 1.0E-174
sp|Q6CQ65|PURA_KLULA Adenylosuccinate synthetase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D19426g PE=3 SV=1 1 423 2.0E-174
sp|C5DD42|PURA_LACTC Adenylosuccinate synthetase OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KLTH0B08118g PE=3 SV=1 1 423 2.0E-174
sp|C5MBF2|PURA_CANTT Adenylosuccinate synthetase OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=CTRG_03394 PE=3 SV=1 1 421 3.0E-174
sp|A3LYS9|PURA_PICST Adenylosuccinate synthetase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PICST_85387 PE=3 SV=1 1 421 5.0E-174
sp|B6JUV1|PURA_SCHJY Adenylosuccinate synthetase OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_00044 PE=3 SV=1 3 423 2.0E-173
sp|C5DYR7|PURA_ZYGRC Adenylosuccinate synthetase OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0F15202g PE=3 SV=1 1 423 5.0E-173
sp|C7Z193|PURA_NECH7 Adenylosuccinate synthetase OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_40313 PE=3 SV=1 3 423 4.0E-172
sp|A5DSZ3|PURA_LODEL Adenylosuccinate synthetase OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=LELG_00479 PE=3 SV=1 1 421 2.0E-171
sp|A6ZRM0|PURA_YEAS7 Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain YJM789) GN=ADE12 PE=3 SV=1 1 423 3.0E-171
sp|Q6FMU9|PURA_CANGA Adenylosuccinate synthetase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K05027g PE=3 SV=1 1 421 4.0E-171
sp|B5VQJ1|PURA_YEAS6 Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain AWRI1631) GN=ADE12 PE=3 SV=1 1 423 1.0E-170
sp|B3LP64|PURA_YEAS1 Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ADE12 PE=3 SV=1 1 423 1.0E-170
sp|C5JKJ6|PURA_AJEDS Adenylosuccinate synthetase OS=Ajellomyces dermatitidis (strain SLH14081) GN=BDBG_03049 PE=3 SV=1 1 423 1.0E-170
sp|C5GA45|PURA_AJEDR Adenylosuccinate synthetase OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=BDCG_00972 PE=3 SV=1 1 423 1.0E-170
sp|P80210|PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE12 PE=1 SV=3 1 423 1.0E-170
sp|C7GPD7|PURA_YEAS2 Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain JAY291) GN=ADE12 PE=3 SV=1 1 423 1.0E-170
sp|C8ZG13|PURA_YEAS8 Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ADE12 PE=3 SV=1 1 423 4.0E-170
sp|A5DIP4|PURA_PICGU Adenylosuccinate synthetase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PGUG_03145 PE=3 SV=1 1 423 1.0E-169
sp|A6R8V2|PURA_AJECN Adenylosuccinate synthetase OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_06743 PE=3 SV=1 1 423 6.0E-169
sp|C6HBB1|PURA_AJECH Adenylosuccinate synthetase OS=Ajellomyces capsulatus (strain H143) GN=HCDG_03993 PE=3 SV=1 1 423 7.0E-169
sp|C0NL18|PURA_AJECG Adenylosuccinate synthetase OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_03848 PE=3 SV=1 1 423 7.0E-169
sp|C1GUH5|PURA_PARBA Adenylosuccinate synthetase OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=PAAG_02170 PE=3 SV=1 1 423 1.0E-168
sp|A7TID0|PURA_VANPO Adenylosuccinate synthetase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1054p43 PE=3 SV=1 1 423 1.0E-168
sp|C0S3Z3|PURA_PARBP Adenylosuccinate synthetase OS=Paracoccidioides brasiliensis (strain Pb03) GN=PABG_02407 PE=3 SV=1 1 423 4.0E-168
sp|C1FYF6|PURA_PARBD Adenylosuccinate synthetase OS=Paracoccidioides brasiliensis (strain Pb18) GN=PADG_00832 PE=3 SV=1 1 423 4.0E-168
sp|A8Q0E3|PURA_MALGO Adenylosuccinate synthetase OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=MGL_2020 PE=3 SV=1 3 423 3.0E-166
sp|Q75E56|PURA_ASHGO Adenylosuccinate synthetase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ABL186W PE=3 SV=2 1 423 1.0E-165
sp|Q6BUG5|PURA_DEBHA Adenylosuccinate synthetase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C10846g PE=3 SV=1 1 423 4.0E-165
sp|C4R8E8|PURA_PICPG Adenylosuccinate synthetase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr4_0613 PE=3 SV=1 1 423 1.0E-164
sp|Q6C482|PURA_YARLI Adenylosuccinate synthetase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E28963g PE=3 SV=1 1 423 5.0E-163
sp|Q4P7R2|PURA_USTMA Adenylosuccinate synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_03851 PE=3 SV=1 2 423 7.0E-163
sp|A8NDT2|PURA_COPC7 Adenylosuccinate synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_10072 PE=3 SV=1 3 423 5.0E-162
sp|B0DQB9|PURA1_LACBS Adenylosuccinate synthetase 1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_295311 PE=3 SV=1 3 423 1.0E-160
sp|P0CQ34|PURA_CRYNJ Adenylosuccinate synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNC04750 PE=3 SV=1 3 421 1.0E-159
sp|P0CQ35|PURA_CRYNB Adenylosuccinate synthetase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBC2420 PE=3 SV=1 3 421 4.0E-159
sp|B4II68|PURA_DROSE Adenylosuccinate synthetase OS=Drosophila sechellia GN=GM23154 PE=3 SV=1 4 421 5.0E-147
sp|B3P321|PURA_DROER Adenylosuccinate synthetase OS=Drosophila erecta GN=GG15093 PE=3 SV=1 4 421 6.0E-147
sp|Q9Y0Y2|PURA_DROME Adenylosuccinate synthetase OS=Drosophila melanogaster GN=AdSS PE=2 SV=1 4 421 2.0E-146
sp|B3M343|PURA_DROAN Adenylosuccinate synthetase OS=Drosophila ananassae GN=GF17012 PE=3 SV=1 4 421 1.0E-145
sp|B0W9B4|PURA_CULQU Adenylosuccinate synthetase OS=Culex quinquefasciatus GN=CPIJ003725 PE=3 SV=1 3 421 2.0E-144
sp|A8IW34|PURA_CHLRE Adenylosuccinate synthetase, chloroplastic OS=Chlamydomonas reinhardtii GN=PURA PE=3 SV=1 3 423 3.0E-144
sp|Q17G75|PURA_AEDAE Adenylosuccinate synthetase OS=Aedes aegypti GN=AAEL003161 PE=3 SV=1 3 421 3.0E-144
sp|A4RYD2|PURA_OSTLU Adenylosuccinate synthetase, chloroplastic OS=Ostreococcus lucimarinus (strain CCE9901) GN=PURA PE=3 SV=1 5 423 4.0E-144
sp|Q299D3|PURA_DROPS Adenylosuccinate synthetase OS=Drosophila pseudoobscura pseudoobscura GN=GA14431 PE=3 SV=2 4 421 4.0E-143
sp|B4G518|PURA_DROPE Adenylosuccinate synthetase OS=Drosophila persimilis GN=GL24277 PE=3 SV=1 4 421 6.0E-143
sp|B4K8W7|PURA_DROMO Adenylosuccinate synthetase OS=Drosophila mojavensis GN=GI22153 PE=3 SV=1 2 421 7.0E-143
sp|B4LWK0|PURA_DROVI Adenylosuccinate synthetase OS=Drosophila virilis GN=GJ24271 PE=3 SV=1 4 421 1.0E-142
sp|B4NFS5|PURA_DROWI Adenylosuccinate synthetase OS=Drosophila willistoni GN=GK22693 PE=3 SV=1 4 421 2.0E-142
sp|A5PJR4|PURA1_BOVIN Adenylosuccinate synthetase isozyme 1 OS=Bos taurus GN=ADSSL1 PE=2 SV=1 3 421 5.0E-142
sp|B4JUE4|PURA_DROGR Adenylosuccinate synthetase OS=Drosophila grimshawi GN=GH15927 PE=3 SV=1 4 421 1.0E-141
sp|P91134|PURA_CAEEL Adenylosuccinate synthetase OS=Caenorhabditis elegans GN=adss-1 PE=3 SV=3 3 423 2.0E-141
sp|A4Z6H1|PURA2_PIG Adenylosuccinate synthetase isozyme 2 OS=Sus scrofa GN=ADSS PE=2 SV=1 3 421 5.0E-141
sp|P46664|PURA2_MOUSE Adenylosuccinate synthetase isozyme 2 OS=Mus musculus GN=Adss PE=1 SV=2 3 421 1.0E-140
sp|B0DUI8|PURA2_LACBS Adenylosuccinate synthetase 2 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=LACBIDRAFT_333008 PE=3 SV=1 2 423 2.0E-140
sp|P30520|PURA2_HUMAN Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens GN=ADSS PE=1 SV=3 3 421 3.0E-140
sp|P21900|PURA_DICDI Adenylosuccinate synthetase OS=Dictyostelium discoideum GN=purA PE=1 SV=1 1 423 3.0E-140
sp|A7MBG0|PURA2_BOVIN Adenylosuccinate synthetase isozyme 2 OS=Bos taurus GN=ADSS PE=2 SV=2 3 421 9.0E-140
sp|Q017T9|PURA_OSTTA Adenylosuccinate synthetase, chloroplastic OS=Ostreococcus tauri GN=PURA PE=3 SV=2 5 423 9.0E-140
sp|A9UTP3|PURA_MONBE Adenylosuccinate synthetase OS=Monosiga brevicollis GN=20027 PE=3 SV=1 3 421 1.0E-139
sp|Q561L1|PUA1A_XENLA Adenylosuccinate synthetase isozyme 1 A OS=Xenopus laevis GN=adssl1-a PE=2 SV=1 3 421 2.0E-139
sp|A4Z6H0|PURA1_PIG Adenylosuccinate synthetase isozyme 1 OS=Sus scrofa GN=ADSSL1 PE=2 SV=1 3 421 3.0E-139
sp|Q68F20|PUA1B_XENLA Adenylosuccinate synthetase isozyme 1 B OS=Xenopus laevis GN=adssl1-b PE=2 SV=1 3 421 4.0E-139
sp|A8X7H5|PURA_CAEBR Adenylosuccinate synthetase OS=Caenorhabditis briggsae GN=adss-1 PE=3 SV=2 3 423 4.0E-139
sp|P28650|PURA1_MOUSE Adenylosuccinate synthetase isozyme 1 OS=Mus musculus GN=Adssl1 PE=1 SV=2 3 421 1.0E-138
sp|A9TIK2|PURA2_PHYPA Adenylosuccinate synthetase 2, chloroplastic OS=Physcomitrella patens subsp. patens GN=PURA2 PE=3 SV=1 5 423 1.0E-138
sp|A2XD35|PURA_ORYSI Adenylosuccinate synthetase, chloroplastic OS=Oryza sativa subsp. indica GN=PURA PE=3 SV=2 5 423 1.0E-138
sp|Q5D8V5|PURA_SCHJA Adenylosuccinate synthetase OS=Schistosoma japonicum PE=2 SV=1 2 423 4.0E-138
sp|Q6DIW6|PURA1_XENTR Adenylosuccinate synthetase isozyme 1 OS=Xenopus tropicalis GN=adssl1 PE=2 SV=1 3 421 4.0E-138
sp|Q10R17|PURA1_ORYSJ Adenylosuccinate synthetase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PURA1 PE=2 SV=1 5 423 4.0E-138
sp|Q8N142|PURA1_HUMAN Adenylosuccinate synthetase isozyme 1 OS=Homo sapiens GN=ADSSL1 PE=1 SV=1 3 421 5.0E-138
sp|Q5ZJL5|PURA2_CHICK Adenylosuccinate synthetase isozyme 2 OS=Gallus gallus GN=ADSS PE=2 SV=1 3 421 1.0E-137
sp|Q568F6|PURA2_DANRE Adenylosuccinate synthetase isozyme 2 OS=Danio rerio GN=adss PE=2 SV=1 3 421 3.0E-137
sp|B5X2Z0|PUA1A_SALSA Adenylosuccinate synthetase isozyme 1 A OS=Salmo salar GN=adssl1a PE=2 SV=1 3 421 3.0E-137
sp|B5DGM3|PUA1B_SALSA Adenylosuccinate synthetase isozyme 1 B OS=Salmo salar GN=adssl1b PE=2 SV=1 3 421 1.0E-136
sp|B3S0D3|PURA_TRIAD Adenylosuccinate synthetase OS=Trichoplax adhaerens GN=TRIADDRAFT_26635 PE=3 SV=1 4 423 2.0E-136
sp|C5WVW2|PURA1_SORBI Adenylosuccinate synthetase 1, chloroplastic OS=Sorghum bicolor GN=PURA1 PE=3 SV=1 5 423 1.0E-135
sp|Q6NSN5|PURA1_DANRE Adenylosuccinate synthetase isozyme 1 OS=Danio rerio GN=adssl1 PE=1 SV=1 3 421 5.0E-135
sp|O24578|PURA_MAIZE Adenylosuccinate synthetase, chloroplastic OS=Zea mays GN=PURA PE=2 SV=1 5 423 1.0E-134
sp|Q851S8|PURA2_ORYSJ Adenylosuccinate synthetase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=PURA2 PE=2 SV=1 5 423 3.0E-133
sp|C5WNV2|PURA2_SORBI Adenylosuccinate synthetase 2, chloroplastic OS=Sorghum bicolor GN=PURA2 PE=3 SV=1 5 423 4.0E-133
sp|B5DGM4|PUA1C_SALSA Adenylosuccinate synthetase isozyme 1 C OS=Salmo salar GN=adssl1c PE=2 SV=1 3 421 8.0E-133
sp|A8QE42|PURA_BRUMA Adenylosuccinate synthetase OS=Brugia malayi GN=Bm1_50695 PE=3 SV=1 2 423 8.0E-133
sp|Q7ZY87|PURA2_XENLA Adenylosuccinate synthetase isozyme 2 OS=Xenopus laevis GN=adss PE=2 SV=1 3 421 1.0E-132
sp|B7FUM7|PURA_PHATC Adenylosuccinate synthetase OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_26256 PE=3 SV=1 4 423 2.0E-132
sp|O24396|PURA_WHEAT Adenylosuccinate synthetase, chloroplastic (Fragment) OS=Triticum aestivum PE=1 SV=1 5 423 4.0E-132
sp|B9SL58|PURA2_RICCO Adenylosuccinate synthetase 2, chloroplastic OS=Ricinus communis GN=PURA2 PE=3 SV=1 5 423 1.0E-131
sp|D0NVH9|PURA_PHYIT Adenylosuccinate synthetase OS=Phytophthora infestans (strain T30-4) GN=PITG_16736 PE=3 SV=1 4 423 2.0E-131
sp|A9XLE1|PURA1_CAPFR Adenylosuccinate synthetase 1, chloroplastic OS=Capsicum frutescens GN=PURA1 PE=3 SV=1 5 423 2.0E-131
sp|Q6T7E8|PURA_TOBAC Adenylosuccinate synthetase, chloroplastic OS=Nicotiana tabacum GN=PURA PE=2 SV=1 5 423 9.0E-131
sp|B9IJ21|PURA_POPTR Adenylosuccinate synthetase, chloroplastic OS=Populus trichocarpa GN=PURA PE=3 SV=1 5 423 9.0E-131
sp|Q6P875|PUA2A_XENTR Adenylosuccinate synthetase isozyme 2 A OS=Xenopus tropicalis GN=adss-a PE=2 SV=1 3 421 3.0E-130
sp|C4QCD2|PURA_SCHMA Adenylosuccinate synthetase OS=Schistosoma mansoni GN=Smp_055990 PE=3 SV=2 1 423 5.0E-130
sp|A0BD92|PURA_PARTE Adenylosuccinate synthetase OS=Paramecium tetraurelia GN=GSPATT00004603001 PE=3 SV=1 3 423 7.0E-130
sp|Q28GB0|PUA2B_XENTR Adenylosuccinate synthetase isozyme 2 B OS=Xenopus tropicalis GN=adss-b PE=2 SV=1 3 421 1.0E-129
sp|A9SCV9|PURA1_PHYPA Adenylosuccinate synthetase 1, chloroplastic OS=Physcomitrella patens subsp. patens GN=PURA1 PE=3 SV=1 5 423 2.0E-129
sp|A9XLG1|PURA_SOLBU Adenylosuccinate synthetase, chloroplastic OS=Solanum bulbocastanum GN=PURA PE=3 SV=1 5 423 9.0E-128
sp|A8FNG4|PURA_CAMJ8 Adenylosuccinate synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=purA PE=3 SV=1 2 421 7.0E-127
sp|Q9PMG4|PURA_CAMJE Adenylosuccinate synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=purA PE=1 SV=1 2 421 1.0E-126
sp|Q96529|PURA_ARATH Adenylosuccinate synthetase, chloroplastic OS=Arabidopsis thaliana GN=PURA PE=1 SV=1 5 423 1.0E-126
sp|Q5HST3|PURA_CAMJR Adenylosuccinate synthetase OS=Campylobacter jejuni (strain RM1221) GN=purA PE=3 SV=1 2 421 2.0E-126
sp|A1W1A5|PURA_CAMJJ Adenylosuccinate synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=purA PE=3 SV=1 2 421 2.0E-126
sp|A7H5L7|PURA_CAMJD Adenylosuccinate synthetase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=purA PE=3 SV=1 2 421 2.0E-126
sp|B9KF91|PURA_CAMLR Adenylosuccinate synthetase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=purA PE=3 SV=1 2 421 1.0E-123
sp|B4PPT4|PURA_DROYA Adenylosuccinate synthetase OS=Drosophila yakuba GN=GE25034 PE=3 SV=1 4 421 1.0E-122
sp|A0PXA8|PURA_CLONN Adenylosuccinate synthetase OS=Clostridium novyi (strain NT) GN=purA PE=3 SV=1 2 421 2.0E-122
sp|A7I328|PURA_CAMHC Adenylosuccinate synthetase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=purA PE=3 SV=1 2 421 3.0E-121
sp|A0RMY9|PURA_CAMFF Adenylosuccinate synthetase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=purA PE=3 SV=1 2 423 3.0E-120
sp|Q8XH63|PURA_CLOPE Adenylosuccinate synthetase OS=Clostridium perfringens (strain 13 / Type A) GN=purA PE=3 SV=1 2 421 9.0E-120
sp|A3DK09|PURA_CLOTH Adenylosuccinate synthetase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=purA PE=3 SV=1 1 421 2.0E-119
sp|A9XLE2|PURA2_CAPFR Adenylosuccinate synthetase 2, chloroplastic OS=Capsicum frutescens GN=PURA2 PE=3 SV=1 5 423 4.0E-119
sp|C1FNL8|PURA_CLOBJ Adenylosuccinate synthetase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=purA PE=3 SV=1 2 421 8.0E-119
sp|A7GJL2|PURA_CLOBL Adenylosuccinate synthetase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=purA PE=3 SV=1 2 421 8.0E-119
sp|B1IHP2|PURA_CLOBK Adenylosuccinate synthetase OS=Clostridium botulinum (strain Okra / Type B1) GN=purA PE=3 SV=1 2 421 8.0E-119
sp|A5I7Y9|PURA_CLOBH Adenylosuccinate synthetase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=purA PE=3 SV=1 2 421 1.0E-118
sp|A7FZF9|PURA_CLOB1 Adenylosuccinate synthetase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=purA PE=3 SV=1 2 421 1.0E-118
sp|B2TRE4|PURA_CLOBB Adenylosuccinate synthetase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=purA PE=3 SV=1 2 421 7.0E-118
sp|A7GVN0|PURA_BACCN Adenylosuccinate synthetase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=purA PE=3 SV=1 2 417 7.0E-118
sp|C3KWG8|PURA_CLOB6 Adenylosuccinate synthetase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=purA PE=3 SV=1 2 421 1.0E-117
sp|Q8KAK6|PURA_CHLTE Adenylosuccinate synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=purA PE=3 SV=1 2 423 1.0E-117
sp|B1KU85|PURA_CLOBM Adenylosuccinate synthetase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=purA PE=3 SV=1 2 421 2.0E-117
sp|B2A449|PURA_NATTJ Adenylosuccinate synthetase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=purA PE=3 SV=1 2 423 2.0E-117
sp|B2V1S6|PURA_CLOBA Adenylosuccinate synthetase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=purA PE=3 SV=1 2 421 4.0E-117
sp|A8AZM9|PURA_STRGC Adenylosuccinate synthetase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=purA PE=3 SV=1 2 418 5.0E-117
sp|A4W440|PURA_STRS2 Adenylosuccinate synthetase OS=Streptococcus suis (strain 98HAH33) GN=purA PE=3 SV=2 2 418 1.0E-116
sp|A4XML6|PURA_CALS8 Adenylosuccinate synthetase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=purA PE=3 SV=1 5 423 1.0E-116
sp|B8FB83|PURA_DESAA Adenylosuccinate synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=purA PE=3 SV=1 4 421 1.0E-116
sp|Q1J8S0|PURA_STRPF Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=purA PE=3 SV=1 2 418 4.0E-116
sp|B5ZA21|PURA_HELPG Adenylosuccinate synthetase OS=Helicobacter pylori (strain G27) GN=purA PE=3 SV=1 1 422 4.0E-116
sp|Q8EKX9|PURA_OCEIH Adenylosuccinate synthetase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=purA PE=3 SV=1 2 417 5.0E-116
sp|Q3B6D0|PURA_CHLL7 Adenylosuccinate synthetase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=purA PE=3 SV=1 2 423 6.0E-116
sp|B0K5I0|PURA_THEPX Adenylosuccinate synthetase OS=Thermoanaerobacter sp. (strain X514) GN=purA PE=3 SV=1 1 421 1.0E-115
sp|B0K8D7|PURA_THEP3 Adenylosuccinate synthetase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=purA PE=3 SV=1 1 421 1.0E-115
sp|Q9ZMI1|PURA_HELPJ Adenylosuccinate synthetase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=purA PE=3 SV=1 1 422 2.0E-115
sp|P65888|PURA_STRR6 Adenylosuccinate synthetase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=purA PE=3 SV=1 2 418 2.0E-115
sp|P65887|PURA_STRPN Adenylosuccinate synthetase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=purA PE=1 SV=1 2 418 2.0E-115
sp|B8ZJJ5|PURA_STRPJ Adenylosuccinate synthetase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=purA PE=3 SV=1 2 418 2.0E-115
sp|Q04N48|PURA_STRP2 Adenylosuccinate synthetase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=purA PE=3 SV=1 2 418 2.0E-115
sp|Q30UH5|PURA_SULDN Adenylosuccinate synthetase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=purA PE=3 SV=1 2 421 2.0E-115
sp|Q3APK8|PURA_CHLCH Adenylosuccinate synthetase OS=Chlorobium chlorochromatii (strain CaD3) GN=purA PE=3 SV=1 1 423 3.0E-115
sp|Q5M2A7|PURA_STRT2 Adenylosuccinate synthetase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=purA PE=3 SV=1 2 418 3.0E-115
sp|Q5LXQ5|PURA_STRT1 Adenylosuccinate synthetase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=purA PE=3 SV=1 2 418 3.0E-115
sp|A6TXB3|PURA_ALKMQ Adenylosuccinate synthetase OS=Alkaliphilus metalliredigens (strain QYMF) GN=purA PE=3 SV=1 2 423 3.0E-115
sp|A2RCA2|PURA_STRPG Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=purA PE=3 SV=1 2 418 3.0E-115
sp|Q3A8S5|PURA_CARHZ Adenylosuccinate synthetase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=purA PE=3 SV=1 1 421 4.0E-115
sp|Q9A1P8|PURA_STRP1 Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M1 GN=purA PE=3 SV=1 2 418 4.0E-115
sp|Q03IE5|PURA_STRTD Adenylosuccinate synthetase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=purA PE=3 SV=1 2 418 5.0E-115
sp|Q1CUP8|PURA_HELPH Adenylosuccinate synthetase OS=Helicobacter pylori (strain HPAG1) GN=purA PE=3 SV=1 1 422 5.0E-115
sp|Q8P2U1|PURA_STRP8 Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=purA PE=3 SV=1 2 418 6.0E-115
sp|Q5XE45|PURA_STRP6 Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=purA PE=3 SV=1 2 418 6.0E-115
sp|A5N4D3|PURA_CLOK5 Adenylosuccinate synthetase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=purA PE=3 SV=1 2 421 6.0E-115
sp|A7ZFJ4|PURA_CAMC1 Adenylosuccinate synthetase OS=Campylobacter concisus (strain 13826) GN=purA PE=3 SV=1 2 423 6.0E-115
sp|B3EGV7|PURA_CHLL2 Adenylosuccinate synthetase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=purA PE=3 SV=1 2 423 7.0E-115
sp|P56137|PURA_HELPY Adenylosuccinate synthetase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=purA PE=3 SV=1 1 422 9.0E-115
sp|Q48VK8|PURA_STRPM Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=purA PE=3 SV=1 2 418 1.0E-114
sp|Q1JIX0|PURA_STRPD Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=purA PE=3 SV=1 2 418 1.0E-114
sp|B5XJH8|PURA_STRPZ Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=purA PE=3 SV=1 2 418 1.0E-114
sp|A4ITU9|PURA_GEOTN Adenylosuccinate synthetase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=purA PE=3 SV=2 2 417 2.0E-114
sp|B6JKI4|PURA_HELP2 Adenylosuccinate synthetase OS=Helicobacter pylori (strain P12) GN=purA PE=3 SV=1 1 422 2.0E-114
sp|A3CQU5|PURA_STRSV Adenylosuccinate synthetase OS=Streptococcus sanguinis (strain SK36) GN=purA PE=3 SV=1 2 418 3.0E-114
sp|B9DT31|PURA_STRU0 Adenylosuccinate synthetase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=purA PE=3 SV=1 2 418 3.0E-114
sp|C5D9W9|PURA_GEOSW Adenylosuccinate synthetase OS=Geobacillus sp. (strain WCH70) GN=purA PE=3 SV=1 2 417 4.0E-114
sp|Q7VHL2|PURA_HELHP Adenylosuccinate synthetase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=purA PE=3 SV=1 1 421 4.0E-114
sp|P0DD55|PURA_STRPQ Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=purA PE=3 SV=1 2 418 4.0E-114
sp|P0DD54|PURA_STRP3 Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=purA PE=3 SV=1 2 418 4.0E-114
sp|A0LWT8|PURA_ACIC1 Adenylosuccinate synthetase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=purA PE=3 SV=1 2 421 4.0E-114
sp|Q9X8P6|PURA_STRCO Adenylosuccinate synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=purA PE=3 SV=1 2 421 5.0E-114
sp|B9MLK0|PURA_CALBD Adenylosuccinate synthetase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=purA PE=3 SV=1 5 423 5.0E-114
sp|B3QQZ0|PURA_CHLP8 Adenylosuccinate synthetase OS=Chlorobaculum parvum (strain NCIB 8327) GN=purA PE=3 SV=1 2 423 6.0E-114
sp|Q7RJF9|PURA_PLAYO Adenylosuccinate synthetase OS=Plasmodium yoelii yoelii GN=PY03301 PE=3 SV=1 5 423 6.0E-114
sp|B3L781|PURA_PLAKH Adenylosuccinate synthetase OS=Plasmodium knowlesi (strain H) GN=PKH_111670 PE=3 SV=1 5 423 7.0E-114
sp|Q8DW14|PURA_STRMU Adenylosuccinate synthetase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=purA PE=3 SV=1 2 418 7.0E-114
sp|Q97D87|PURA_CLOAB Adenylosuccinate synthetase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=purA PE=3 SV=1 2 421 7.0E-114
sp|B8D1A3|PURA_HALOH Adenylosuccinate synthetase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=purA PE=3 SV=1 4 423 7.0E-114
sp|A8FJC0|PURA_BACP2 Adenylosuccinate synthetase OS=Bacillus pumilus (strain SAFR-032) GN=purA PE=3 SV=1 2 417 9.0E-114
sp|Q65CR5|PURA_BACLD Adenylosuccinate synthetase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=purA PE=3 SV=1 2 417 1.0E-113
sp|Q5KU76|PURA_GEOKA Adenylosuccinate synthetase OS=Geobacillus kaustophilus (strain HTA426) GN=purA PE=3 SV=1 2 417 1.0E-113
sp|A6M3K0|PURA_CLOB8 Adenylosuccinate synthetase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=purA PE=3 SV=1 2 421 1.0E-113
sp|Q1JNS3|PURA_STRPC Adenylosuccinate synthetase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=purA PE=3 SV=1 2 418 1.0E-113
sp|B3DNT3|PURA_BIFLD Adenylosuccinate synthetase OS=Bifidobacterium longum (strain DJO10A) GN=purA PE=3 SV=1 4 421 2.0E-113
sp|O68581|PURA_FUSNU Adenylosuccinate synthetase OS=Fusobacterium nucleatum GN=purA PE=3 SV=1 4 422 2.0E-113
sp|B7GT29|PURA_BIFLS Adenylosuccinate synthetase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=purA PE=3 SV=1 4 421 3.0E-113
sp|B2US87|PURA_HELPS Adenylosuccinate synthetase OS=Helicobacter pylori (strain Shi470) GN=purA PE=3 SV=1 1 422 3.0E-113
sp|Q2RG43|PURA_MOOTA Adenylosuccinate synthetase OS=Moorella thermoacetica (strain ATCC 39073) GN=purA PE=3 SV=1 2 421 3.0E-113
sp|Q9K5R0|PURA_BACHD Adenylosuccinate synthetase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=purA PE=3 SV=1 2 417 4.0E-113
sp|Q8R6T8|PURA_CALS4 Adenylosuccinate synthetase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=purA PE=3 SV=1 2 421 4.0E-113
sp|A1BJ01|PURA_CHLPD Adenylosuccinate synthetase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=purA PE=3 SV=1 2 423 5.0E-113
sp|C0MAE4|PURA_STRE4 Adenylosuccinate synthetase OS=Streptococcus equi subsp. equi (strain 4047) GN=purA PE=3 SV=1 2 418 7.0E-113
sp|C0R2E2|PURA_BRAHW Adenylosuccinate synthetase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=purA PE=3 SV=1 2 421 7.0E-113
sp|A4SCU2|PURA_CHLPM Adenylosuccinate synthetase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=purA PE=3 SV=1 2 423 8.0E-113
sp|Q8G6T9|PURA_BIFLO Adenylosuccinate synthetase OS=Bifidobacterium longum (strain NCC 2705) GN=purA PE=3 SV=1 4 421 8.0E-113
sp|B9L6S4|PURA_NAUPA Adenylosuccinate synthetase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=purA PE=3 SV=1 1 423 9.0E-113
sp|A0ZZG5|PURA_BIFAA Adenylosuccinate synthetase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=purA PE=3 SV=1 4 421 9.0E-113
sp|A5K2F3|PURA_PLAVS Adenylosuccinate synthetase OS=Plasmodium vivax (strain Salvador I) GN=PVX_114710 PE=3 SV=1 5 423 1.0E-112
sp|Q82ER6|PURA_STRAW Adenylosuccinate synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=purA PE=3 SV=1 2 421 1.0E-112
sp|B1X5S1|PURA_PAUCH Adenylosuccinate synthetase, organellar chromatophore OS=Paulinella chromatophora GN=PCC_0881 PE=3 SV=1 4 421 1.0E-112
sp|C0MFY0|PURA_STRS7 Adenylosuccinate synthetase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=purA PE=3 SV=1 2 418 1.0E-112
sp|B1XIL5|PURA_SYNP2 Adenylosuccinate synthetase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=purA PE=3 SV=1 4 421 2.0E-112
sp|Q7V6A8|PURA_PROMM Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9313) GN=purA PE=3 SV=1 4 421 2.0E-112
sp|A6Q5H2|PURA_NITSB Adenylosuccinate synthetase OS=Nitratiruptor sp. (strain SB155-2) GN=purA PE=3 SV=1 2 423 2.0E-112
sp|A2C7N3|PURA_PROM3 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9303) GN=purA PE=3 SV=1 4 421 2.0E-112
sp|P58793|PURA_FUSNN Adenylosuccinate synthetase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=purA PE=3 SV=1 4 422 3.0E-112
sp|B8DVC2|PURA_BIFA0 Adenylosuccinate synthetase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=purA PE=3 SV=1 4 421 3.0E-112
sp|Q17W85|PURA_HELAH Adenylosuccinate synthetase OS=Helicobacter acinonychis (strain Sheeba) GN=purA PE=3 SV=1 1 422 4.0E-112
sp|Q9CE93|PURA_LACLA Adenylosuccinate synthetase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=purA PE=3 SV=1 2 418 4.0E-112
sp|A9BEC8|PURA_PROM4 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9211) GN=purA PE=3 SV=1 3 421 9.0E-112
sp|A2BVG8|PURA_PROM5 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9515) GN=purA PE=3 SV=1 4 421 9.0E-112
sp|Q7V2H1|PURA_PROMP Adenylosuccinate synthetase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=purA PE=3 SV=1 4 421 1.0E-111
sp|Q9U8D3|PURA_PLAFA Adenylosuccinate synthetase OS=Plasmodium falciparum GN=Adss PE=1 SV=3 5 423 2.0E-111
sp|Q8IDF6|PURA_PLAF7 Adenylosuccinate synthetase OS=Plasmodium falciparum (isolate 3D7) GN=Adss PE=3 SV=1 5 423 2.0E-111
sp|A2BPY8|PURA_PROMS Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain AS9601) GN=purA PE=3 SV=1 4 421 2.0E-111
sp|B2J8B7|PURA_NOSP7 Adenylosuccinate synthetase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=purA PE=3 SV=1 4 421 2.0E-111
sp|Q02WK8|PURA_LACLS Adenylosuccinate synthetase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=purA PE=3 SV=1 2 418 2.0E-111
sp|B8I5L3|PURA_CLOCE Adenylosuccinate synthetase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=purA PE=3 SV=1 4 421 3.0E-111
sp|Q8YMZ0|PURA_NOSS1 Adenylosuccinate synthetase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=purA PE=3 SV=2 4 421 3.0E-111
sp|A5GC19|PURA_GEOUR Adenylosuccinate synthetase OS=Geobacter uraniireducens (strain Rf4) GN=purA PE=3 SV=1 4 421 4.0E-111
sp|B4SC75|PURA_PELPB Adenylosuccinate synthetase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=purA PE=3 SV=1 2 423 4.0E-111
sp|A7HDA9|PURA_ANADF Adenylosuccinate synthetase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=purA PE=3 SV=1 3 421 4.0E-111
sp|C0ZA40|PURA_BREBN Adenylosuccinate synthetase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=purA PE=3 SV=1 1 421 5.0E-111
sp|A2RN80|PURA_LACLM Adenylosuccinate synthetase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=purA PE=3 SV=1 2 418 5.0E-111
sp|B9M1R2|PURA_GEODF Adenylosuccinate synthetase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=purA PE=3 SV=1 4 421 5.0E-111
sp|A7ZAP4|PURA_BACMF Adenylosuccinate synthetase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=purA PE=3 SV=1 2 417 6.0E-111
sp|A8G3M2|PURA_PROM2 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9215) GN=purA PE=3 SV=1 4 421 6.0E-111
sp|Q4YU52|PURA_PLABA Adenylosuccinate synthetase OS=Plasmodium berghei (strain Anka) GN=PB001073.02.0 PE=3 SV=1 5 423 8.0E-111
sp|Q4X2S8|PURA_PLACH Adenylosuccinate synthetase OS=Plasmodium chabaudi GN=PC000072.01.0 PE=3 SV=1 5 423 9.0E-111
sp|Q3MBG1|PURA_ANAVT Adenylosuccinate synthetase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=purA PE=3 SV=1 4 421 1.0E-110
sp|Q6HAG9|PURA_BACHK Adenylosuccinate synthetase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=purA PE=3 SV=1 2 418 1.0E-110
sp|Q81JI9|PURA_BACAN Adenylosuccinate synthetase OS=Bacillus anthracis GN=purA PE=1 SV=1 2 418 1.0E-110
sp|A0RLP6|PURA_BACAH Adenylosuccinate synthetase OS=Bacillus thuringiensis (strain Al Hakam) GN=purA PE=3 SV=2 2 418 1.0E-110
sp|P73290|PURA_SYNY3 Adenylosuccinate synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=purA PE=3 SV=2 4 421 2.0E-110
sp|A3PBN1|PURA_PROM0 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9301) GN=purA PE=3 SV=1 4 421 2.0E-110
sp|A0LHR1|PURA_SYNFM Adenylosuccinate synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=purA PE=3 SV=1 4 421 2.0E-110
sp|B1VMC3|PURA_STRGG Adenylosuccinate synthetase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=purA PE=3 SV=1 2 421 2.0E-110
sp|C4L014|PURA_EXISA Adenylosuccinate synthetase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=purA PE=3 SV=1 2 421 4.0E-110
sp|Q7VD77|PURA_PROMA Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=purA PE=3 SV=1 4 421 6.0E-110
sp|P65886|PURA_STRA5 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=purA PE=3 SV=1 2 418 1.0E-109
sp|P65885|PURA_STRA3 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=purA PE=3 SV=1 2 418 1.0E-109
sp|B0CBU2|PURA_ACAM1 Adenylosuccinate synthetase OS=Acaryochloris marina (strain MBIC 11017) GN=purA PE=3 SV=1 4 421 1.0E-109
sp|A6Q6M5|PURA_SULNB Adenylosuccinate synthetase OS=Sulfurovum sp. (strain NBC37-1) GN=purA PE=3 SV=1 2 423 2.0E-109
sp|Q3JZ68|PURA_STRA1 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=purA PE=3 SV=1 2 418 2.0E-109
sp|Q1WRH2|PURA_LACS1 Adenylosuccinate synthetase OS=Lactobacillus salivarius (strain UCC118) GN=purA PE=3 SV=1 2 418 2.0E-109
sp|Q2JQX5|PURA_SYNJA Adenylosuccinate synthetase OS=Synechococcus sp. (strain JA-3-3Ab) GN=purA PE=3 SV=1 3 421 3.0E-109
sp|Q5N1D4|PURA_SYNP6 Adenylosuccinate synthetase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=purA PE=3 SV=1 4 421 3.0E-109
sp|Q88SV6|PURA_LACPL Adenylosuccinate synthetase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=purA PE=3 SV=2 2 418 3.0E-109
sp|Q5X7Q5|PURA_LEGPA Adenylosuccinate synthetase OS=Legionella pneumophila (strain Paris) GN=purA PE=3 SV=1 4 421 3.0E-109
sp|Q39QK1|PURA_GEOMG Adenylosuccinate synthetase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=purA PE=3 SV=1 4 421 4.0E-109
sp|B7JXN4|PURA_CYAP8 Adenylosuccinate synthetase OS=Cyanothece sp. (strain PCC 8801) GN=purA PE=3 SV=1 4 421 4.0E-109
sp|Q31KI0|PURA_SYNE7 Adenylosuccinate synthetase OS=Synechococcus elongatus (strain PCC 7942) GN=purA PE=3 SV=1 4 421 4.0E-109
sp|B2GEZ1|PURA_LACF3 Adenylosuccinate synthetase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=purA PE=3 SV=1 1 421 5.0E-109
sp|Q0I8J6|PURA_SYNS3 Adenylosuccinate synthetase OS=Synechococcus sp. (strain CC9311) GN=purA PE=3 SV=1 4 421 5.0E-109
sp|Q747F9|PURA_GEOSL Adenylosuccinate synthetase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=purA PE=3 SV=1 4 421 6.0E-109
sp|Q5WAI0|PURA_BACSK Adenylosuccinate synthetase OS=Bacillus clausii (strain KSM-K16) GN=purA PE=3 SV=1 2 417 7.0E-109
sp|B7KCX9|PURA_CYAP7 Adenylosuccinate synthetase OS=Cyanothece sp. (strain PCC 7424) GN=purA PE=3 SV=1 4 421 7.0E-109
sp|A4J9P7|PURA_DESRM Adenylosuccinate synthetase OS=Desulfotomaculum reducens (strain MI-1) GN=purA PE=3 SV=1 1 421 7.0E-109
sp|B0JXF6|PURA_MICAN Adenylosuccinate synthetase OS=Microcystis aeruginosa (strain NIES-843) GN=purA PE=3 SV=1 4 421 8.0E-109
sp|Q8RNM2|PURA_LEGPN Adenylosuccinate synthetase OS=Legionella pneumophila GN=purA PE=3 SV=1 4 421 9.0E-109
sp|Q5ZY86|PURA_LEGPH Adenylosuccinate synthetase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=purA PE=3 SV=1 4 421 9.0E-109
sp|Q3KIY4|PURA_PSEPF Adenylosuccinate synthetase OS=Pseudomonas fluorescens (strain Pf0-1) GN=purA PE=3 SV=1 4 421 9.0E-109
sp|A5IHA9|PURA_LEGPC Adenylosuccinate synthetase OS=Legionella pneumophila (strain Corby) GN=purA PE=3 SV=1 4 421 1.0E-108
sp|A5GSC3|PURA_SYNR3 Adenylosuccinate synthetase OS=Synechococcus sp. (strain RCC307) GN=purA PE=3 SV=1 4 421 1.0E-108
sp|C3KDW8|PURA_PSEFS Adenylosuccinate synthetase OS=Pseudomonas fluorescens (strain SBW25) GN=purA PE=3 SV=1 4 421 1.0E-108
sp|Q5WZ56|PURA_LEGPL Adenylosuccinate synthetase OS=Legionella pneumophila (strain Lens) GN=purA PE=3 SV=1 4 421 1.0E-108
sp|Q181Q7|PURA_PEPD6 Adenylosuccinate synthetase OS=Peptoclostridium difficile (strain 630) GN=purA PE=3 SV=1 5 423 2.0E-108
sp|Q72WW1|PURA_BACC1 Adenylosuccinate synthetase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=purA PE=3 SV=1 2 418 2.0E-108
sp|Q814H1|PURA_BACCR Adenylosuccinate synthetase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=purA PE=3 SV=1 2 418 2.0E-108
sp|Q10ZD0|PURA_TRIEI Adenylosuccinate synthetase OS=Trichodesmium erythraeum (strain IMS101) GN=purA PE=3 SV=1 4 421 2.0E-108
sp|Q31C27|PURA_PROM9 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain MIT 9312) GN=purA PE=3 SV=1 4 421 2.0E-108
sp|B0TA52|PURA_HELMI Adenylosuccinate synthetase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=purA PE=3 SV=1 2 421 3.0E-108
sp|A4WQW4|PURA_RHOS5 Adenylosuccinate synthetase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=purA PE=3 SV=1 3 421 5.0E-108
sp|A5GJD1|PURA_SYNPW Adenylosuccinate synthetase OS=Synechococcus sp. (strain WH7803) GN=purA PE=3 SV=1 4 421 6.0E-108
sp|Q7M7V8|PURA_WOLSU Adenylosuccinate synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=purA PE=3 SV=1 2 423 9.0E-108
sp|A6H0U4|PURA_FLAPJ Adenylosuccinate synthetase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=purA PE=3 SV=1 4 423 9.0E-108
sp|A1SPV6|PURA_NOCSJ Adenylosuccinate synthetase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=purA PE=3 SV=1 2 421 1.0E-107
sp|Q7NG93|PURA_GLOVI Adenylosuccinate synthetase OS=Gloeobacter violaceus (strain PCC 7421) GN=purA PE=3 SV=1 4 421 1.0E-107
sp|Q839Y4|PURA_ENTFA Adenylosuccinate synthetase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=purA PE=3 SV=1 2 418 1.0E-107
sp|Q2IQF7|PURA_ANADE Adenylosuccinate synthetase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=purA PE=3 SV=1 4 421 1.0E-107
sp|A8ZTF0|PURA_DESOH Adenylosuccinate synthetase OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=purA PE=3 SV=1 4 421 2.0E-107
sp|Q7VKR5|PURA_HAEDU Adenylosuccinate synthetase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=purA PE=3 SV=1 5 423 2.0E-107
sp|C5C333|PURA_BEUC1 Adenylosuccinate synthetase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=purA PE=3 SV=1 2 423 2.0E-107
sp|Q3J0Z3|PURA_RHOS4 Adenylosuccinate synthetase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=purA PE=3 SV=1 3 421 2.0E-107
sp|B9KKA7|PURA_RHOSK Adenylosuccinate synthetase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=purA PE=3 SV=1 3 421 2.0E-107
sp|A8ER43|PURA_ARCB4 Adenylosuccinate synthetase OS=Arcobacter butzleri (strain RM4018) GN=purA PE=3 SV=1 2 423 2.0E-107
sp|A3PL98|PURA_RHOS1 Adenylosuccinate synthetase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=purA PE=3 SV=1 3 421 2.0E-107
sp|B8JDH9|PURA_ANAD2 Adenylosuccinate synthetase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=purA PE=3 SV=1 4 421 3.0E-107
sp|B0BQ12|PURA_ACTPJ Adenylosuccinate synthetase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=purA PE=3 SV=1 5 423 3.0E-107
sp|Q630D5|PURA_BACCZ Adenylosuccinate synthetase OS=Bacillus cereus (strain ZK / E33L) GN=purA PE=3 SV=1 2 418 5.0E-107
sp|A3N181|PURA_ACTP2 Adenylosuccinate synthetase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=purA PE=3 SV=1 5 423 5.0E-107
sp|A7H0A8|PURA_CAMC5 Adenylosuccinate synthetase OS=Campylobacter curvus (strain 525.92) GN=purA PE=3 SV=1 2 423 6.0E-107
sp|Q2J4S8|PURA_FRASC Adenylosuccinate synthetase OS=Frankia sp. (strain CcI3) GN=purA PE=3 SV=1 2 421 6.0E-107
sp|B4UGW9|PURA_ANASK Adenylosuccinate synthetase OS=Anaeromyxobacter sp. (strain K) GN=purA PE=3 SV=1 4 421 7.0E-107
sp|Q7U5D4|PURA_SYNPX Adenylosuccinate synthetase OS=Synechococcus sp. (strain WH8102) GN=purA PE=3 SV=1 4 421 7.0E-107
sp|Q46GR9|PURA_PROMT Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain NATL2A) GN=purA PE=3 SV=1 4 421 7.0E-107
sp|A2C0W6|PURA_PROM1 Adenylosuccinate synthetase OS=Prochlorococcus marinus (strain NATL1A) GN=purA PE=3 SV=1 4 421 7.0E-107
sp|A9MFN5|PURA_SALAR Adenylosuccinate synthetase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=purA PE=3 SV=1 4 423 1.0E-106
sp|B3H1V8|PURA_ACTP7 Adenylosuccinate synthetase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=purA PE=3 SV=1 5 423 1.0E-106
sp|B8G0I5|PURA_DESHD Adenylosuccinate synthetase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=purA PE=3 SV=1 1 423 1.0E-106
sp|A8LDR3|PURA_FRASN Adenylosuccinate synthetase OS=Frankia sp. (strain EAN1pec) GN=purA PE=3 SV=1 2 417 1.0E-106
sp|A6VQD4|PURA_ACTSZ Adenylosuccinate synthetase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=purA PE=3 SV=1 2 417 1.0E-106
sp|Q9PG47|PURA_XYLFA Adenylosuccinate synthetase OS=Xylella fastidiosa (strain 9a5c) GN=purA PE=3 SV=2 2 421 2.0E-106
sp|B1YG93|PURA_EXIS2 Adenylosuccinate synthetase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=purA PE=3 SV=1 2 421 3.0E-106
sp|C4L9M5|PURA_TOLAT Adenylosuccinate synthetase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=purA PE=3 SV=1 2 423 3.0E-106
sp|P57889|PURA_PASMU Adenylosuccinate synthetase OS=Pasteurella multocida (strain Pm70) GN=purA PE=3 SV=1 2 423 3.0E-106
sp|Q3ALR7|PURA_SYNSC Adenylosuccinate synthetase OS=Synechococcus sp. (strain CC9605) GN=purA PE=3 SV=1 4 421 4.0E-106
sp|B1I6P8|PURA_DESAP Adenylosuccinate synthetase OS=Desulforudis audaxviator (strain MP104C) GN=purA PE=3 SV=1 1 421 4.0E-106
sp|O67321|PURA_AQUAE Adenylosuccinate synthetase OS=Aquifex aeolicus (strain VF5) GN=purA PE=3 SV=1 4 422 5.0E-106
sp|Q24MC6|PURA_DESHY Adenylosuccinate synthetase OS=Desulfitobacterium hafniense (strain Y51) GN=purA PE=3 SV=1 1 423 5.0E-106
sp|Q74KY3|PURA_LACJO Adenylosuccinate synthetase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=purA PE=3 SV=1 2 421 6.0E-106
sp|Q0RBA3|PURA_FRAAA Adenylosuccinate synthetase OS=Frankia alni (strain ACN14a) GN=purA PE=3 SV=1 2 421 6.0E-106
sp|B1WSJ0|PURA_CYAA5 Adenylosuccinate synthetase OS=Cyanothece sp. (strain ATCC 51142) GN=purA PE=3 SV=1 4 421 6.0E-106
sp|Q88DD8|PURA_PSEPK Adenylosuccinate synthetase OS=Pseudomonas putida (strain KT2440) GN=purA PE=3 SV=1 4 421 6.0E-106
sp|B0KKZ0|PURA_PSEPG Adenylosuccinate synthetase OS=Pseudomonas putida (strain GB-1) GN=purA PE=3 SV=1 4 421 6.0E-106
sp|A5W9S5|PURA_PSEP1 Adenylosuccinate synthetase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=purA PE=3 SV=1 4 421 6.0E-106
sp|Q65S32|PURA_MANSM Adenylosuccinate synthetase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=purA PE=3 SV=1 2 417 6.0E-106
sp|Q1D936|PURA_MYXXD Adenylosuccinate synthetase OS=Myxococcus xanthus (strain DK 1622) GN=purA PE=3 SV=1 4 421 7.0E-106
sp|B0U498|PURA_XYLFM Adenylosuccinate synthetase OS=Xylella fastidiosa (strain M12) GN=purA PE=3 SV=1 2 421 8.0E-106
sp|Q2S1J1|PURA_SALRD Adenylosuccinate synthetase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=purA PE=3 SV=1 3 421 8.0E-106
sp|A4XPZ3|PURA_PSEMY Adenylosuccinate synthetase OS=Pseudomonas mendocina (strain ymp) GN=purA PE=3 SV=1 4 421 8.0E-106
sp|B4S195|PURA_ALTMD Adenylosuccinate synthetase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=purA PE=3 SV=1 4 421 9.0E-106
sp|Q1I454|PURA_PSEE4 Adenylosuccinate synthetase OS=Pseudomonas entomophila (strain L48) GN=purA PE=3 SV=1 4 421 9.0E-106
sp|Q2LSI8|PURA_SYNAS Adenylosuccinate synthetase OS=Syntrophus aciditrophicus (strain SB) GN=purA PE=3 SV=2 4 421 1.0E-105
sp|B3EAS4|PURA_GEOLS Adenylosuccinate synthetase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=purA PE=3 SV=1 4 421 1.0E-105
sp|A1ALC9|PURA_PELPD Adenylosuccinate synthetase OS=Pelobacter propionicus (strain DSM 2379) GN=purA PE=3 SV=1 5 421 1.0E-105
sp|P65882|PURA_SALTY Adenylosuccinate synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=purA PE=3 SV=2 4 423 2.0E-105
sp|P65883|PURA_SALTI Adenylosuccinate synthetase OS=Salmonella typhi GN=purA PE=3 SV=2 4 423 2.0E-105
sp|A9N4Z1|PURA_SALPB Adenylosuccinate synthetase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B4TSF7|PURA_SALSV Adenylosuccinate synthetase OS=Salmonella schwarzengrund (strain CVM19633) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B5BKI5|PURA_SALPK Adenylosuccinate synthetase OS=Salmonella paratyphi A (strain AKU_12601) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|Q5PL58|PURA_SALPA Adenylosuccinate synthetase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B5R9C3|PURA_SALG2 Adenylosuccinate synthetase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B5R0P3|PURA_SALEP Adenylosuccinate synthetase OS=Salmonella enteritidis PT4 (strain P125109) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B5FRN3|PURA_SALDC Adenylosuccinate synthetase OS=Salmonella dublin (strain CT_02021853) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B4T2S2|PURA_SALNS Adenylosuccinate synthetase OS=Salmonella newport (strain SL254) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B4TFB1|PURA_SALHS Adenylosuccinate synthetase OS=Salmonella heidelberg (strain SL476) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|C0Q6D4|PURA_SALPC Adenylosuccinate synthetase OS=Salmonella paratyphi C (strain RKS4594) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|B8F8E6|PURA_HAEPS Adenylosuccinate synthetase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=purA PE=3 SV=1 5 423 2.0E-105
sp|B1JAI0|PURA_PSEPW Adenylosuccinate synthetase OS=Pseudomonas putida (strain W619) GN=purA PE=3 SV=1 4 421 2.0E-105
sp|B5F392|PURA_SALA4 Adenylosuccinate synthetase OS=Salmonella agona (strain SL483) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|A5FHR3|PURA_FLAJ1 Adenylosuccinate synthetase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=purA PE=3 SV=1 4 423 2.0E-105
sp|Q92MA5|PURA_RHIME Adenylosuccinate synthetase OS=Rhizobium meliloti (strain 1021) GN=purA PE=3 SV=1 4 421 3.0E-105
sp|A8LIN4|PURA_DINSH Adenylosuccinate synthetase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=purA PE=3 SV=1 4 421 3.0E-105
sp|Q328F6|PURA_SHIDS Adenylosuccinate synthetase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|Q31TA7|PURA_SHIBS Adenylosuccinate synthetase OS=Shigella boydii serotype 4 (strain Sb227) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B2TY52|PURA_SHIB3 Adenylosuccinate synthetase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7LLV9|PURA_ESCF3 Adenylosuccinate synthetase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|Q1R383|PURA_ECOUT Adenylosuccinate synthetase OS=Escherichia coli (strain UTI89 / UPEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B1LQJ7|PURA_ECOSM Adenylosuccinate synthetase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B6I281|PURA_ECOSE Adenylosuccinate synthetase OS=Escherichia coli (strain SE11) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7NGB1|PURA_ECOLU Adenylosuccinate synthetase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|P0A7D4|PURA_ECOLI Adenylosuccinate synthetase OS=Escherichia coli (strain K12) GN=purA PE=1 SV=2 4 423 4.0E-105
sp|B1IT29|PURA_ECOLC Adenylosuccinate synthetase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|P0A7D5|PURA_ECOL6 Adenylosuccinate synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=purA PE=3 SV=2 4 423 4.0E-105
sp|Q0T9L6|PURA_ECOL5 Adenylosuccinate synthetase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|A1AJ82|PURA_ECOK1 Adenylosuccinate synthetase OS=Escherichia coli O1:K1 / APEC GN=purA PE=3 SV=1 4 423 4.0E-105
sp|A8A7S2|PURA_ECOHS Adenylosuccinate synthetase OS=Escherichia coli O9:H4 (strain HS) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B1XDS8|PURA_ECODH Adenylosuccinate synthetase OS=Escherichia coli (strain K12 / DH10B) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|C4ZR54|PURA_ECOBW Adenylosuccinate synthetase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7M8T7|PURA_ECO8A Adenylosuccinate synthetase OS=Escherichia coli O8 (strain IAI1) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7MSJ5|PURA_ECO81 Adenylosuccinate synthetase OS=Escherichia coli O81 (strain ED1a) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7NTN3|PURA_ECO7I Adenylosuccinate synthetase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B5Z2I3|PURA_ECO5E Adenylosuccinate synthetase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|P0A7D6|PURA_ECO57 Adenylosuccinate synthetase OS=Escherichia coli O157:H7 GN=purA PE=3 SV=2 4 423 4.0E-105
sp|B7LC36|PURA_ECO55 Adenylosuccinate synthetase OS=Escherichia coli (strain 55989 / EAEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7MKY1|PURA_ECO45 Adenylosuccinate synthetase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B7UQI6|PURA_ECO27 Adenylosuccinate synthetase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|A7ZV47|PURA_ECO24 Adenylosuccinate synthetase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|B1HPK4|PURA_LYSSC Adenylosuccinate synthetase OS=Lysinibacillus sphaericus (strain C3-41) GN=purA PE=3 SV=1 2 418 4.0E-105
sp|Q2JQ36|PURA_SYNJB Adenylosuccinate synthetase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=purA PE=3 SV=1 4 421 4.0E-105
sp|Q92FQ5|PURA_LISIN Adenylosuccinate synthetase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=purA PE=3 SV=1 2 417 4.0E-105
sp|Q87B33|PURA_XYLFT Adenylosuccinate synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=purA PE=3 SV=1 2 421 4.0E-105
sp|B2I7V8|PURA_XYLF2 Adenylosuccinate synthetase OS=Xylella fastidiosa (strain M23) GN=purA PE=3 SV=1 2 421 4.0E-105
sp|Q3YUG6|PURA_SHISS Adenylosuccinate synthetase OS=Shigella sonnei (strain Ss046) GN=purA PE=3 SV=1 4 423 4.0E-105
sp|A8YTK4|PURA_LACH4 Adenylosuccinate synthetase OS=Lactobacillus helveticus (strain DPC 4571) GN=purA PE=3 SV=1 2 421 5.0E-105
sp|Q1GF65|PURA_RUEST Adenylosuccinate synthetase OS=Ruegeria sp. (strain TM1040) GN=purA PE=3 SV=1 4 421 6.0E-105
sp|A7MM94|PURA_CROS8 Adenylosuccinate synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=purA PE=3 SV=1 4 423 6.0E-105
sp|Q57GL4|PURA_SALCH Adenylosuccinate synthetase OS=Salmonella choleraesuis (strain SC-B67) GN=purA PE=3 SV=1 4 423 6.0E-105
sp|Q2J0H0|PURA_RHOP2 Adenylosuccinate synthetase OS=Rhodopseudomonas palustris (strain HaA2) GN=purA PE=3 SV=1 4 421 6.0E-105
sp|Q48A17|PURA_COLP3 Adenylosuccinate synthetase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=purA PE=3 SV=1 4 423 6.0E-105
sp|A1SA65|PURA_SHEAM Adenylosuccinate synthetase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=purA PE=3 SV=1 4 423 6.0E-105
sp|Q4N3F4|PURA_THEPA Adenylosuccinate synthetase OS=Theileria parva GN=TP04_0033 PE=3 SV=1 2 423 7.0E-105
sp|Q8NM16|PURA_CORGL Adenylosuccinate synthetase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=purA PE=3 SV=1 2 421 7.0E-105
sp|Q3AWR7|PURA_SYNS9 Adenylosuccinate synthetase OS=Synechococcus sp. (strain CC9902) GN=purA PE=3 SV=1 4 421 7.0E-105
sp|Q8YAR1|PURA_LISMO Adenylosuccinate synthetase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=purA PE=3 SV=1 2 417 7.0E-105
sp|B1JMN3|PURA_YERPY Adenylosuccinate synthetase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|Q66FB0|PURA_YERPS Adenylosuccinate synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|A4TRN4|PURA_YERPP Adenylosuccinate synthetase OS=Yersinia pestis (strain Pestoides F) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|Q1CEG0|PURA_YERPN Adenylosuccinate synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|A9QYM6|PURA_YERPG Adenylosuccinate synthetase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|Q8ZIV7|PURA_YERPE Adenylosuccinate synthetase OS=Yersinia pestis GN=purA PE=1 SV=1 4 423 8.0E-105
sp|B2K2K4|PURA_YERPB Adenylosuccinate synthetase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|Q1C105|PURA_YERPA Adenylosuccinate synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=purA PE=3 SV=1 4 423 8.0E-105
sp|Q04EU8|PURA_OENOB Adenylosuccinate synthetase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=purA PE=3 SV=1 4 415 8.0E-105
sp|Q8UCN6|PURA_AGRFC Adenylosuccinate synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=purA PE=3 SV=1 4 421 9.0E-105
sp|Q89EM1|PURA_BRADU Adenylosuccinate synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=purA PE=3 SV=1 4 421 9.0E-105
sp|Q4KJ68|PURA_PSEF5 Adenylosuccinate synthetase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=purA PE=3 SV=1 4 421 9.0E-105
sp|A4QHG2|PURA_CORGB Adenylosuccinate synthetase OS=Corynebacterium glutamicum (strain R) GN=purA PE=3 SV=1 2 421 9.0E-105
sp|B1KIH9|PURA_SHEWM Adenylosuccinate synthetase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=purA PE=3 SV=1 4 421 1.0E-104
sp|A7FMX4|PURA_YERP3 Adenylosuccinate synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=purA PE=3 SV=1 4 423 1.0E-104
sp|B2HPW4|PURA_MYCMM Adenylosuccinate synthetase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=purA PE=3 SV=1 2 423 1.0E-104
sp|A4Z0B8|PURA_BRASO Adenylosuccinate synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=purA PE=3 SV=1 4 421 1.0E-104
sp|A5ED09|PURA_BRASB Adenylosuccinate synthetase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=purA PE=3 SV=1 4 421 1.0E-104
sp|Q4LAK0|PURA_STAHJ Adenylosuccinate synthetase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=purA PE=3 SV=1 2 418 1.0E-104
sp|C3PJK0|PURA_CORA7 Adenylosuccinate synthetase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=purA PE=3 SV=1 2 423 1.0E-104
sp|Q6AN65|PURA_DESPS Adenylosuccinate synthetase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=purA PE=3 SV=1 2 417 1.0E-104
sp|A0L7T9|PURA_MAGMM Adenylosuccinate synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=purA PE=3 SV=2 4 421 2.0E-104
sp|B8HY86|PURA_CYAP4 Adenylosuccinate synthetase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=purA PE=3 SV=1 4 421 2.0E-104
sp|Q47KH7|PURA_THEFY Adenylosuccinate synthetase OS=Thermobifida fusca (strain YX) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|Q045S7|PURA_LACGA Adenylosuccinate synthetase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|Q83P33|PURA_SHIFL Adenylosuccinate synthetase OS=Shigella flexneri GN=purA PE=3 SV=1 4 423 2.0E-104
sp|Q0SXA5|PURA_SHIF8 Adenylosuccinate synthetase OS=Shigella flexneri serotype 5b (strain 8401) GN=purA PE=3 SV=1 4 423 2.0E-104
sp|B2SNJ3|PURA_XANOP Adenylosuccinate synthetase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|Q8PBR6|PURA_XANCP Adenylosuccinate synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|B0RYD5|PURA_XANCB Adenylosuccinate synthetase OS=Xanthomonas campestris pv. campestris (strain B100) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|Q4URT6|PURA_XANC8 Adenylosuccinate synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|Q8EAG5|PURA_SHEON Adenylosuccinate synthetase OS=Shewanella oneidensis (strain MR-1) GN=purA PE=3 SV=1 4 421 2.0E-104
sp|B8DAL0|PURA_LISMH Adenylosuccinate synthetase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=purA PE=3 SV=1 2 417 2.0E-104
sp|C1DLQ8|PURA_AZOVD Adenylosuccinate synthetase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=purA PE=3 SV=1 4 421 2.0E-104
sp|Q5FHY4|PURA_LACAC Adenylosuccinate synthetase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=purA PE=3 SV=1 2 421 2.0E-104
sp|A5F534|PURA_VIBC3 Adenylosuccinate synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=purA PE=3 SV=1 4 423 2.0E-104
sp|C6DFJ2|PURA_PECCP Adenylosuccinate synthetase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=purA PE=3 SV=1 4 423 2.0E-104
sp|Q11DJ4|PURA_CHESB Adenylosuccinate synthetase OS=Chelativorans sp. (strain BNC1) GN=purA PE=3 SV=1 4 421 2.0E-104
sp|Q3BWF4|PURA_XANC5 Adenylosuccinate synthetase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=purA PE=3 SV=1 2 421 3.0E-104
sp|Q8PNB5|PURA_XANAC Adenylosuccinate synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=purA PE=3 SV=1 2 421 3.0E-104
sp|Q03TS9|PURA_LACBA Adenylosuccinate synthetase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=purA PE=3 SV=1 2 418 3.0E-104
sp|C3MI14|PURA_RHISN Adenylosuccinate synthetase OS=Rhizobium sp. (strain NGR234) GN=purA PE=3 SV=1 4 421 3.0E-104
sp|A0AEN2|PURA_LISW6 Adenylosuccinate synthetase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=purA PE=3 SV=1 2 417 3.0E-104
sp|Q725A8|PURA_LISMF Adenylosuccinate synthetase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=purA PE=3 SV=1 2 417 3.0E-104
sp|C1KV62|PURA_LISMC Adenylosuccinate synthetase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=purA PE=3 SV=1 2 417 3.0E-104
sp|Q5LTU4|PURA_RUEPO Adenylosuccinate synthetase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=purA PE=3 SV=1 4 421 3.0E-104
sp|B9JRD7|PURA_AGRVS Adenylosuccinate synthetase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=purA PE=3 SV=1 4 421 4.0E-104
sp|A1JIS0|PURA_YERE8 Adenylosuccinate synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=purA PE=3 SV=1 4 423 5.0E-104
sp|Q4JXT3|PURA_CORJK Adenylosuccinate synthetase OS=Corynebacterium jeikeium (strain K411) GN=purA PE=3 SV=1 2 421 5.0E-104
sp|B0TUV4|PURA_SHEHH Adenylosuccinate synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=purA PE=3 SV=1 4 421 5.0E-104
sp|A6TH93|PURA_KLEP7 Adenylosuccinate synthetase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=purA PE=3 SV=1 4 423 5.0E-104
sp|A4FQK6|PURA_SACEN Adenylosuccinate synthetase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=purA PE=3 SV=1 2 423 6.0E-104
sp|B8CIP5|PURA_SHEPW Adenylosuccinate synthetase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=purA PE=3 SV=1 4 421 7.0E-104
sp|Q1QY21|PURA_CHRSD Adenylosuccinate synthetase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=purA PE=3 SV=1 4 421 7.0E-104
sp|C3LRR4|PURA_VIBCM Adenylosuccinate synthetase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=purA PE=3 SV=1 4 423 8.0E-104
sp|Q9KNX8|PURA_VIBCH Adenylosuccinate synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=purA PE=3 SV=3 4 423 8.0E-104
sp|A8H8L8|PURA_SHEPA Adenylosuccinate synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=purA PE=3 SV=1 4 421 8.0E-104
sp|Q2SBC8|PURA_HAHCH Adenylosuccinate synthetase OS=Hahella chejuensis (strain KCTC 2396) GN=purA PE=3 SV=1 4 421 8.0E-104
sp|A8G8V4|PURA_SERP5 Adenylosuccinate synthetase OS=Serratia proteamaculans (strain 568) GN=purA PE=3 SV=1 4 423 8.0E-104
sp|Q6D072|PURA_PECAS Adenylosuccinate synthetase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=purA PE=3 SV=1 4 423 8.0E-104
sp|Q3A828|PURA_PELCD Adenylosuccinate synthetase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=purA PE=3 SV=1 4 421 8.0E-104
sp|B5Y325|PURA_KLEP3 Adenylosuccinate synthetase OS=Klebsiella pneumoniae (strain 342) GN=purA PE=3 SV=1 4 423 9.0E-104
sp|Q5QW95|PURA_IDILO Adenylosuccinate synthetase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=purA PE=3 SV=1 4 421 9.0E-104
sp|A7HV25|PURA_PARL1 Adenylosuccinate synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=purA PE=3 SV=1 5 421 9.0E-104
sp|P29726|PURA_BACSU Adenylosuccinate synthetase OS=Bacillus subtilis (strain 168) GN=purA PE=3 SV=1 2 417 1.0E-103
sp|Q5H4F2|PURA_XANOR Adenylosuccinate synthetase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=purA PE=3 SV=2 2 421 1.0E-103
sp|Q2P782|PURA_XANOM Adenylosuccinate synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=purA PE=3 SV=1 2 421 1.0E-103
sp|B4F271|PURA_PROMH Adenylosuccinate synthetase OS=Proteus mirabilis (strain HI4320) GN=purA PE=3 SV=1 4 421 1.0E-103
sp|B1MIV1|PURA_MYCA9 Adenylosuccinate synthetase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=purA PE=3 SV=1 2 423 1.0E-103
sp|Q6GKS8|PURA_STAAR Adenylosuccinate synthetase OS=Staphylococcus aureus (strain MRSA252) GN=purA PE=3 SV=1 2 418 1.0E-103
sp|P99099|PURA_STAAN Adenylosuccinate synthetase OS=Staphylococcus aureus (strain N315) GN=purA PE=1 SV=1 2 418 1.0E-103
sp|P65884|PURA_STAAM Adenylosuccinate synthetase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=purA PE=3 SV=1 2 418 1.0E-103
sp|A0PS01|PURA_MYCUA Adenylosuccinate synthetase OS=Mycobacterium ulcerans (strain Agy99) GN=purA PE=3 SV=1 2 423 1.0E-103
sp|B1VHT9|PURA_CORU7 Adenylosuccinate synthetase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=purA PE=3 SV=1 2 421 1.0E-103
sp|A8AMM3|PURA_CITK8 Adenylosuccinate synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=purA PE=3 SV=1 4 423 2.0E-103
sp|B2VCW8|PURA_ERWT9 Adenylosuccinate synthetase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=purA PE=3 SV=1 4 423 2.0E-103
sp|Q9HUM6|PURA_PSEAE Adenylosuccinate synthetase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=purA PE=3 SV=1 4 421 2.0E-103
sp|Q02F80|PURA_PSEAB Adenylosuccinate synthetase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=purA PE=3 SV=1 4 421 2.0E-103
sp|B7V201|PURA_PSEA8 Adenylosuccinate synthetase OS=Pseudomonas aeruginosa (strain LESB58) GN=purA PE=3 SV=1 4 421 2.0E-103
sp|B5ECF3|PURA_GEOBB Adenylosuccinate synthetase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=purA PE=3 SV=1 4 421 2.0E-103
sp|Q6N1V9|PURA_RHOPA Adenylosuccinate synthetase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=purA PE=3 SV=1 4 421 2.0E-103
sp|B6J083|PURA_COXB2 Adenylosuccinate synthetase OS=Coxiella burnetii (strain CbuG_Q212) GN=purA PE=3 SV=1 1 423 3.0E-103
sp|B6J734|PURA_COXB1 Adenylosuccinate synthetase OS=Coxiella burnetii (strain CbuK_Q154) GN=purA PE=3 SV=1 1 423 3.0E-103
sp|Q131X4|PURA_RHOPS Adenylosuccinate synthetase OS=Rhodopseudomonas palustris (strain BisB5) GN=purA PE=3 SV=1 4 421 3.0E-103
sp|A8I1V7|PURA_AZOC5 Adenylosuccinate synthetase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=purA PE=3 SV=2 4 421 3.0E-103
sp|Q21HA8|PURA_SACD2 Adenylosuccinate synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=purA PE=3 SV=1 4 421 3.0E-103
sp|B0UW92|PURA_HISS2 Adenylosuccinate synthetase OS=Histophilus somni (strain 2336) GN=purA PE=3 SV=1 2 417 3.0E-103
sp|Q8NYX6|PURA_STAAW Adenylosuccinate synthetase OS=Staphylococcus aureus (strain MW2) GN=purA PE=3 SV=1 2 418 4.0E-103
sp|Q6GD73|PURA_STAAS Adenylosuccinate synthetase OS=Staphylococcus aureus (strain MSSA476) GN=purA PE=3 SV=1 2 418 4.0E-103
sp|Q5HJX8|PURA_STAAC Adenylosuccinate synthetase OS=Staphylococcus aureus (strain COL) GN=purA PE=3 SV=1 2 418 4.0E-103
sp|Q03CT6|PURA_LACC3 Adenylosuccinate synthetase OS=Lactobacillus casei (strain ATCC 334) GN=purA PE=3 SV=1 2 418 4.0E-103
sp|Q20Z24|PURA_RHOPB Adenylosuccinate synthetase OS=Rhodopseudomonas palustris (strain BisB18) GN=purA PE=3 SV=1 4 421 4.0E-103
sp|A4W5R8|PURA_ENT38 Adenylosuccinate synthetase OS=Enterobacter sp. (strain 638) GN=purA PE=3 SV=1 4 423 4.0E-103
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0006164 purine nucleotide biosynthetic process Yes
GO:0004019 adenylosuccinate synthase activity Yes
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016874 ligase activity No
GO:0009987 cellular process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901576 organic substance biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008152 metabolic process No
GO:0017076 purine nucleotide binding No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0032553 ribonucleotide binding No
GO:0044281 small molecule metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0032561 guanyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019001 guanyl nucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0072522 purine-containing compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0006753 nucleoside phosphate metabolic process No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009165 nucleotide biosynthetic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0036094 small molecule binding No
GO:0019438 aromatic compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0019637 organophosphate metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1071
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4616 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2993
Ophiocordyceps camponoti-floridani Ophcf2|04548
Ophiocordyceps camponoti-rufipedis Ophun1|6921
Ophiocordyceps kimflemingae Ophio5|855
Ophiocordyceps subramaniannii Hirsu2|10035

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4616
MATLILGSQWGDEGKGKLSDILCRDAEICARAAGGHNAGHSVVANGVSYDFHLLPSGLINPHCLNLIGSAVVFNV
RIFFSEIEKLEERGLENVRSRLLVSDRAQVNLDLHSRVDGLEEAELGGNKIGTTGRGIGPSYATKAARNGIRVHE
IFDQDRFEEKLRKLAVGYRKRFGDLLEYDVEEEIVRFREYRRTLAPFCVDAVQLIKQAQDRGTKILVEGANALML
DLDYGTYPFVTSSNTGLGGIFTGLAINPRKIDQIIGVVKAYTTRVGEGIFKTEDEGEDGRQLQEVGREWGVSTGR
KRRCGWLDLIVLKYSTAINHYTALNLTKLDVLSGFKTIKVAVAYKDPKTQEELDYFPADLDFLDKCQVVYREFEG
WQTPIASVRKFEQLPSQAQSYIKFIEDFVHVPVSWIGTGPSRDDMIYR*
Coding >OphauG2|4616
ATGGCAACGCTAATTTTGGGTTCCCAATGGGGTGACGAGGGCAAAGGCAAGCTCAGCGACATTCTCTGTCGTGAC
GCCGAGATTTGCGCCCGTGCTGCCGGCGGCCACAACGCGGGACATTCAGTTGTCGCCAATGGCGTCTCGTACGAC
TTCCACCTGTTGCCTTCGGGCCTGATCAATCCTCACTGCCTCAATCTGATAGGCTCGGCTGTCGTGTTCAACGTG
AGGATATTCTTTAGCGAGATTGAGAAGCTCGAGGAGCGCGGCCTCGAAAACGTGCGCTCGCGCCTCCTTGTTAGC
GACCGAGCCCAGGTCAATCTCGACTTGCACTCACGCGTCGACGGGCTCGAAGAAGCAGAACTCGGAGGCAACAAG
ATTGGGACGACTGGCCGTGGCATTGGGCCCTCGTACGCAACCAAGGCGGCTCGCAACGGCATCCGCGTACATGAA
ATCTTTGACCAGGACCGCTTTGAAGAAAAGCTGCGTAAGCTGGCAGTAGGCTATAGGAAGCGCTTTGGCGACTTG
CTCGAGTACGATGTCGAGGAAGAGATTGTTCGTTTCCGCGAATATCGACGGACGCTGGCGCCTTTTTGCGTTGAT
GCTGTCCAACTCATCAAGCAGGCACAGGATCGTGGCACCAAGATCCTCGTCGAAGGCGCAAATGCTCTCATGCTG
GACCTGGACTATGGAACTTATCCCTTTGTCACCAGCAGCAATACGGGCCTGGGAGGCATCTTTACCGGCCTGGCC
ATTAACCCGCGAAAAATCGATCAAATCATTGGCGTTGTCAAGGCTTACACGACGAGGGTAGGAGAAGGCATCTTC
AAGACCGAGGACGAGGGTGAAGACGGCCGCCAGCTGCAGGAAGTCGGCCGTGAATGGGGTGTCTCGACGGGTCGC
AAACGTCGCTGCGGCTGGCTTGACCTTATTGTGCTCAAGTATTCAACGGCTATAAACCACTACACGGCCCTCAAT
CTCACCAAGCTCGACGTTCTTAGCGGCTTCAAGACCATCAAGGTTGCTGTTGCGTACAAGGATCCCAAGACCCAA
GAGGAGCTCGATTACTTTCCGGCGGATCTCGACTTTCTCGACAAGTGCCAAGTTGTCTATCGCGAATTTGAGGGC
TGGCAAACGCCCATTGCCAGCGTCAGAAAATTCGAGCAACTACCAAGCCAAGCGCAAAGCTATATCAAGTTTATC
GAAGACTTTGTTCACGTGCCCGTGTCATGGATAGGGACTGGCCCATCGAGAGATGACATGATATACCGATAA
Transcript >OphauG2|4616
ATGGCAACGCTAATTTTGGGTTCCCAATGGGGTGACGAGGGCAAAGGCAAGCTCAGCGACATTCTCTGTCGTGAC
GCCGAGATTTGCGCCCGTGCTGCCGGCGGCCACAACGCGGGACATTCAGTTGTCGCCAATGGCGTCTCGTACGAC
TTCCACCTGTTGCCTTCGGGCCTGATCAATCCTCACTGCCTCAATCTGATAGGCTCGGCTGTCGTGTTCAACGTG
AGGATATTCTTTAGCGAGATTGAGAAGCTCGAGGAGCGCGGCCTCGAAAACGTGCGCTCGCGCCTCCTTGTTAGC
GACCGAGCCCAGGTCAATCTCGACTTGCACTCACGCGTCGACGGGCTCGAAGAAGCAGAACTCGGAGGCAACAAG
ATTGGGACGACTGGCCGTGGCATTGGGCCCTCGTACGCAACCAAGGCGGCTCGCAACGGCATCCGCGTACATGAA
ATCTTTGACCAGGACCGCTTTGAAGAAAAGCTGCGTAAGCTGGCAGTAGGCTATAGGAAGCGCTTTGGCGACTTG
CTCGAGTACGATGTCGAGGAAGAGATTGTTCGTTTCCGCGAATATCGACGGACGCTGGCGCCTTTTTGCGTTGAT
GCTGTCCAACTCATCAAGCAGGCACAGGATCGTGGCACCAAGATCCTCGTCGAAGGCGCAAATGCTCTCATGCTG
GACCTGGACTATGGAACTTATCCCTTTGTCACCAGCAGCAATACGGGCCTGGGAGGCATCTTTACCGGCCTGGCC
ATTAACCCGCGAAAAATCGATCAAATCATTGGCGTTGTCAAGGCTTACACGACGAGGGTAGGAGAAGGCATCTTC
AAGACCGAGGACGAGGGTGAAGACGGCCGCCAGCTGCAGGAAGTCGGCCGTGAATGGGGTGTCTCGACGGGTCGC
AAACGTCGCTGCGGCTGGCTTGACCTTATTGTGCTCAAGTATTCAACGGCTATAAACCACTACACGGCCCTCAAT
CTCACCAAGCTCGACGTTCTTAGCGGCTTCAAGACCATCAAGGTTGCTGTTGCGTACAAGGATCCCAAGACCCAA
GAGGAGCTCGATTACTTTCCGGCGGATCTCGACTTTCTCGACAAGTGCCAAGTTGTCTATCGCGAATTTGAGGGC
TGGCAAACGCCCATTGCCAGCGTCAGAAAATTCGAGCAACTACCAAGCCAAGCGCAAAGCTATATCAAGTTTATC
GAAGACTTTGTTCACGTGCCCGTGTCATGGATAGGGACTGGCCCATCGAGAGATGACATGATATACCGATAA
Gene >OphauG2|4616
ATGGCAACGCTAATTTTGGGTTCCCAATGGGGTATTCCTGATTTTGTGCACAGTGCATGGCAAGGCAGTCGTTGA
CTTGGTGATTGCAGGTGACGAGGGCAAAGGCAAGCTCAGCGACATTCTCTGTCGTGACGCCGAGATTTGCGCCCG
TGCTGCCGGCGGCCACAACGCGGGACATTCAGTTGTGTACGTTGCTCGCAGTGCTTTTATGGGCCGAAGCTGACA
CAAGGTCGTTTTGTATGTAGCGCCAATGGCGTCTCGTACGAGTAGGCAGTCTCCAACAAGTTTTCCGCCGACGAG
CAAGTCAAAGCCGTTGACCCAAACCACTGTAGCTTCCACCTGTTGCCTTCGGGCCTGATCAATCCTCACTGCCTC
AATCTGATAGGCTCGGCTGTCGTGTTCAACGTGAGGATATTCTTTAGCGAGATTGAGAAGCTCGAGGAGCGCGGC
CTCGAAAACGTGCGCTCGCGCCTCCTTGTTAGCGACCGAGCCCAGGTCAATCTCGACTTGCACTCACGCGTCGAC
GGGCTCGAAGAAGCAGAACTCGGAGGCAACAAGATTGGGACGACTGGCCGTGGCATTGGGCCCTCGTACGCAACC
AAGGCGGCTCGCAACGGCATCCGCGTACATGAAATCTTTGACCAGGACCGCTTTGAAGAAAAGCTGCGTAAGCTG
GCAGTAGGCTATAGGAAGCGCTTTGGCGACTTGCTCGAGTACGATGTCGAGGAAGAGATTGTTCGTTTCCGCGAA
TATCGACGGACGCTGGCGCCTTTTTGCGTTGATGCTGTCCAACTCATCAAGCAGGCACAGGATCGTGGCACCAAG
ATCCTCGTCGAAGGCGCAAATGCTCTCATGCTGGACCTGGACTATGGCAAGTAGACAGAGGCCTTGGTAGGGCGC
CCCCGTGACTGATGAGTCAATTCCAGGAACTTATCCCTTTGTCACCAGCAGCAATACGGGCCTGGGAGGCATCTT
TACCGGCCTGGCCATTAACCCGCGAAAAATCGAGTAAGTAGTATCAACTCCCCGAGGACCCATTGCAATGGTGTT
TGTGGCTGACAGCATGCTCTAGTCAAATCATTGGGTAGGTCATGGCCACTCTTGACCTTTGCATCAATAGTGTGC
TGACCTTGTGATTGTGTTAGCGTTGTCAAGGCTTACACGGTACGTCTGTACTCTGCACTGCCATGTCAAGCTGCT
TCTGGAAGCCTAGAGACGCATTGTTTGGTGTGTTTGAAATGTCTCCTCTAGCACATGCTGACTTGCCATGAGGCA
GACGAGGGTAGGAGAAGGCATCTTCAAGACCGAGGACGAGGGTGAAGACGGCCGCCAGCTGCAGGAAGTCGGCCG
TGAATGGGGTGTCTCGACGGGTCGCAAACGTCGCTGCGGCTGGCTTGACCTTATTGTGCTCAAGTATTCAACGGC
TATAAACCACTACACGGCCCTCAATCTCACCAAGCTCGACGTTCTTAGCGGCTTCAAGACCATCAAGGTTGCTGT
TGCGTACAAGGATCCCAAGACCCAAGAGGAGCTCGATTACTTTCCGGCGGATCTCGACTTTCTCGACAAGTGCCA
AGTTGTCTATCGCGAATTTGAGGGCTGGCAAACGCCCATTGCCAGCGTCAGAAAATTCGTAAGATATGGCTCAAC
GCCTGTTTTTCAATGCCAGACTGACAATATGTATGTGCAGGAGCAACTACCAAGCCAAGCGCAAAGCTATATCAA
GTTTATCGAAGACTTTGTTCACGTGCCCGTGTCATGGATAGGGACTGGCCGTGAGTGGCTCGACGCCAAGGCTTG
GGCGTTTTTGACGCGTGCTGACTGAATAAATGGCTACAGCATCGAGAGATGACATGATATACCGATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail