Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4613
Gene name
LocationContig_393:9696..10677
Strand+
Gene length (bp)981
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 1.4E-17 42 135
PF13649 Methyltransf_25 Methyltransferase domain 3.3E-14 42 131
PF13847 Methyltransf_31 Methyltransferase domain 5.7E-08 40 134
PF13489 Methyltransf_23 Methyltransferase domain 2.7E-07 14 115
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.9E-04 29 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRG1 PE=1 SV=1 2 307 1.0E-33
sp|A6ZRD1|TMT1_YEAS7 Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=TMT1 PE=3 SV=1 1 306 2.0E-33
sp|P32643|TMT1_YEAST Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMT1 PE=1 SV=1 1 306 3.0E-33
sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 11 138 4.0E-13
sp|C0Z787|BIOC_BREBN Malonyl-[acyl-carrier protein] O-methyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=bioC PE=3 SV=1 2 173 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38892|CRG1_YEAST Probable S-adenosylmethionine-dependent methyltransferase CRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CRG1 PE=1 SV=1 2 307 1.0E-33
sp|A6ZRD1|TMT1_YEAS7 Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain YJM789) GN=TMT1 PE=3 SV=1 1 306 2.0E-33
sp|P32643|TMT1_YEAST Trans-aconitate 3-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMT1 PE=1 SV=1 1 306 3.0E-33
sp|Q55EX9|Y8948_DICDI Putative methyltransferase DDB_G0268948 OS=Dictyostelium discoideum GN=DDB_G0268948 PE=1 SV=2 11 138 4.0E-13
sp|C0Z787|BIOC_BREBN Malonyl-[acyl-carrier protein] O-methyltransferase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=bioC PE=3 SV=1 2 173 2.0E-09
sp|P65349|Y3374_MYCBO Uncharacterized methyltransferase Mb3374 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb3374 PE=3 SV=1 3 140 4.0E-09
sp|P9WK01|Y3342_MYCTU Uncharacterized methyltransferase Rv3342 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3342 PE=1 SV=1 3 140 4.0E-09
sp|P9WK00|Y3342_MYCTO Uncharacterized methyltransferase MT3445 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT3445 PE=3 SV=1 3 140 4.0E-09
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 40 146 7.0E-09
sp|Q9UTA9|YL89_SCHPO Uncharacterized methyltransferase C25B8.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.09 PE=3 SV=1 12 174 1.0E-07
sp|Q9UTA8|YL8A_SCHPO Uncharacterized methyltransferase-like C25B8.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.10 PE=3 SV=1 11 140 2.0E-07
sp|A6UYW3|BIOC_PSEA7 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=bioC PE=3 SV=1 34 135 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4613
MSTFGKSTFSAAAYAAARPTYPASLYNRIMRFHGNGPRRKLLDLGCGHGVVSRAMSAYFDSVVGLDVAANMVEQA
SLMTHDSKISFSQGHAEDLSWLADGSIDMVVSGQAAHWFDFTKAWPELARVIPSGGTLAFWGYRDPLFIGHPRAS
FLLDHFLYGGDNVVAPGLEGMGAYWEQPGRDRVRRLMRDQEPPASDWQDVQRIEHDIQLTTEQDAGGETLDGAWL
KLRIRLGEMEAYLRTHSAYQGWKDAHTEIKSKDQGGEPGDIIDVLMSRIVDSEAEWKALGQGWPEAEVKVVWGSY
ILMARRR*
Coding >OphauG2|4613
ATGTCCACCTTTGGAAAATCGACTTTTTCGGCCGCCGCCTACGCCGCTGCCAGGCCAACATATCCTGCTAGTCTC
TACAACAGAATCATGCGATTTCACGGCAATGGACCCCGCCGCAAGCTTCTGGACCTGGGATGTGGCCACGGCGTC
GTCTCACGTGCAATGAGTGCCTACTTTGACAGTGTCGTGGGGCTCGACGTGGCGGCCAACATGGTGGAGCAGGCT
TCCTTGATGACTCACGATAGCAAAATCAGCTTTTCCCAAGGTCATGCCGAAGACCTGTCTTGGTTGGCAGACGGC
TCTATAGACATGGTGGTGTCTGGCCAAGCTGCACATTGGTTTGATTTTACCAAGGCGTGGCCAGAGCTGGCACGC
GTTATACCATCGGGCGGAACCCTGGCCTTTTGGGGGTACAGGGACCCCCTCTTTATCGGCCACCCTCGTGCCAGC
TTCCTCTTGGACCACTTCTTGTACGGTGGAGACAATGTCGTAGCGCCAGGGCTTGAGGGCATGGGGGCCTATTGG
GAGCAGCCGGGGAGAGACCGGGTGCGCCGATTAATGCGTGACCAAGAACCGCCGGCGAGCGACTGGCAAGATGTG
CAGAGAATCGAGCACGACATCCAACTCACGACTGAGCAAGACGCTGGTGGCGAGACTTTAGACGGGGCGTGGCTG
AAGCTACGCATACGTTTGGGCGAGATGGAGGCATACTTGCGCACTCACAGCGCTTACCAGGGATGGAAAGACGCC
CATACAGAAATCAAGAGTAAGGATCAAGGCGGAGAGCCCGGCGATATCATTGACGTGCTCATGAGTCGCATCGTG
GATTCGGAAGCCGAGTGGAAGGCGCTGGGCCAAGGTTGGCCAGAGGCCGAGGTGAAGGTTGTGTGGGGAAGCTAT
ATCTTGATGGCTAGGCGGCGTTGA
Transcript >OphauG2|4613
ATGTCCACCTTTGGAAAATCGACTTTTTCGGCCGCCGCCTACGCCGCTGCCAGGCCAACATATCCTGCTAGTCTC
TACAACAGAATCATGCGATTTCACGGCAATGGACCCCGCCGCAAGCTTCTGGACCTGGGATGTGGCCACGGCGTC
GTCTCACGTGCAATGAGTGCCTACTTTGACAGTGTCGTGGGGCTCGACGTGGCGGCCAACATGGTGGAGCAGGCT
TCCTTGATGACTCACGATAGCAAAATCAGCTTTTCCCAAGGTCATGCCGAAGACCTGTCTTGGTTGGCAGACGGC
TCTATAGACATGGTGGTGTCTGGCCAAGCTGCACATTGGTTTGATTTTACCAAGGCGTGGCCAGAGCTGGCACGC
GTTATACCATCGGGCGGAACCCTGGCCTTTTGGGGGTACAGGGACCCCCTCTTTATCGGCCACCCTCGTGCCAGC
TTCCTCTTGGACCACTTCTTGTACGGTGGAGACAATGTCGTAGCGCCAGGGCTTGAGGGCATGGGGGCCTATTGG
GAGCAGCCGGGGAGAGACCGGGTGCGCCGATTAATGCGTGACCAAGAACCGCCGGCGAGCGACTGGCAAGATGTG
CAGAGAATCGAGCACGACATCCAACTCACGACTGAGCAAGACGCTGGTGGCGAGACTTTAGACGGGGCGTGGCTG
AAGCTACGCATACGTTTGGGCGAGATGGAGGCATACTTGCGCACTCACAGCGCTTACCAGGGATGGAAAGACGCC
CATACAGAAATCAAGAGTAAGGATCAAGGCGGAGAGCCCGGCGATATCATTGACGTGCTCATGAGTCGCATCGTG
GATTCGGAAGCCGAGTGGAAGGCGCTGGGCCAAGGTTGGCCAGAGGCCGAGGTGAAGGTTGTGTGGGGAAGCTAT
ATCTTGATGGCTAGGCGGCGTTGA
Gene >OphauG2|4613
ATGTCCACCTTTGGGTAAGTGCGTCTGTTTTAAAGACTGGTCTGGTTGTCGACTAACATAATGCACAATAGAAAA
TCGACTTTTTCGGCCGCCGCCTACGCCGCTGCCAGGCCAACATATCCTGCTAGTCTCTACAACAGAATCATGCGA
TTTCACGGCAATGGACCCCGCCGCAAGCTTCTGGACCTGGGATGTGGCCACGGCGTCGTCTCACGTGCAATGAGT
GCCTACTTTGACAGTGTCGTGGGGCTCGACGTGGCGGCCAACATGGTGGAGCAGGCTTCCTTGATGACTCACGAT
AGCAAAATCAGCTTTTCCCAAGGTCATGCCGAAGACCTGTCTTGGTTGGCAGACGGCTCTATAGACATGGTGGTG
TCTGGCCAAGCTGCACATTGGTTTGATTTTACCAAGGCGTGGCCAGAGCTGGCACGCGTTATACCATCGGGCGGA
ACCCTGGCCTTTTGGGGGTACAGGGACCCCCTCTTTATCGGCCACCCTCGTGCCAGCTTCCTCTTGGACCACTTC
TTGTACGGTGGAGACAATGTCGTAGCGCCAGGGCTTGAGGGCATGGGGGCCTATTGGGAGCAGCCGGGGAGAGAC
CGGGTGCGCCGATTAATGCGTGACCAAGAACCGCCGGCGAGCGACTGGCAAGATGTGCAGAGAATCGAGCACGAC
ATCCAACTCACGACTGAGCAAGACGCTGGTGGCGAGACTTTAGACGGGGCGTGGCTGAAGCTACGCATACGTTTG
GGCGAGATGGAGGCATACTTGCGCACTCACAGCGCTTACCAGGGATGGAAAGACGCCCATACAGAAATCAAGAGT
AAGGATCAAGGCGGAGAGCCCGGCGATATCATTGACGTGCTCATGAGTCGCATCGTGGATTCGGAAGCCGAGTGG
AAGGCGCTGGGCCAAGGTTGGCCAGAGGCCGAGGTGAAGGTTGTGTGGGGAAGCTATATCTTGATGGCTAGGCGG
CGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail