Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4612
Gene name
LocationContig_393:8735..9277
Strand-
Gene length (bp)542
Transcript length (bp)432
Coding sequence length (bp)432
Protein length (aa) 144

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13380 CoA_binding_2 CoA binding domain 5.6E-16 23 110

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4612 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2205
Ophiocordyceps camponoti-floridani Ophcf2|02821
Ophiocordyceps camponoti-rufipedis Ophun1|6170
Ophiocordyceps kimflemingae Ophio5|6968
Ophiocordyceps subramaniannii Hirsu2|4971

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4612
MMSGEAAARSFFSSPLFAVVGATSNTAKFGHKVTPVNPSAPQVTVQGKDYAAAASLADLPQPSDTSVSIITPPAV
TASVLQEARKLGIPAVWLQPGTYDKGVLEVALADGAFKSVVYGNGGRGSEGWCVLVDGERALADVGKL*
Coding >OphauG2|4612
ATGATGTCTGGCGAAGCCGCGGCTCGTTCGTTCTTCTCGTCGCCCCTCTTTGCCGTGGTCGGCGCCACGTCCAAC
ACGGCCAAATTCGGGCACAAAGTCACTCCAGTCAATCCGAGCGCTCCACAAGTCACGGTCCAGGGCAAAGACTAT
GCCGCAGCAGCGAGTCTGGCTGATTTGCCGCAGCCCAGCGACACTTCTGTGTCCATCATCACGCCGCCAGCCGTG
ACAGCAAGCGTGTTGCAAGAGGCTCGCAAACTTGGCATTCCTGCCGTGTGGCTCCAGCCGGGCACTTACGACAAG
GGTGTTTTAGAGGTGGCCTTGGCCGACGGGGCTTTCAAGTCGGTTGTCTATGGCAATGGAGGCCGTGGCAGCGAG
GGCTGGTGTGTGCTTGTTGATGGGGAGAGGGCTCTGGCCGATGTGGGAAAGCTGTAA
Transcript >OphauG2|4612
ATGATGTCTGGCGAAGCCGCGGCTCGTTCGTTCTTCTCGTCGCCCCTCTTTGCCGTGGTCGGCGCCACGTCCAAC
ACGGCCAAATTCGGGCACAAAGTCACTCCAGTCAATCCGAGCGCTCCACAAGTCACGGTCCAGGGCAAAGACTAT
GCCGCAGCAGCGAGTCTGGCTGATTTGCCGCAGCCCAGCGACACTTCTGTGTCCATCATCACGCCGCCAGCCGTG
ACAGCAAGCGTGTTGCAAGAGGCTCGCAAACTTGGCATTCCTGCCGTGTGGCTCCAGCCGGGCACTTACGACAAG
GGTGTTTTAGAGGTGGCCTTGGCCGACGGGGCTTTCAAGTCGGTTGTCTATGGCAATGGAGGCCGTGGCAGCGAG
GGCTGGTGTGTGCTTGTTGATGGGGAGAGGGCTCTGGCCGATGTGGGAAAGCTGTAA
Gene >OphauG2|4612
ATGATGTCTGGCGAAGCCGCGGCTCGTTCGTTCTTCTCGTCGCCCCTCTTTGCCGTGGTCGGCGCCACGTCCAAC
ACGGCCAAATTCGGGCACAAAGGTAGGCTGCGTTGCTGGCGGGGAGAGCAAAGCGTCAAGCAAAGATTTGGGTTG
AGGGCGCGCTAATGCTCTCTGCTGTTTACGCATGGTATCTGGCCCATGGGCTGCCAGTCACTCCAGTCAATCCGA
GCGCTCCACAAGTCACGGTCCAGGGCAAAGACTATGCCGCAGCAGCGAGTCTGGCTGATTTGCCGCAGCCCAGCG
ACACTTCTGTGTCCATCATCACGCCGCCAGCCGTGACAGCAAGCGTGTTGCAAGAGGCTCGCAAACTTGGCATTC
CTGCCGTGTGGCTCCAGCCGGGCACTTACGACAAGGGTGTTTTAGAGGTGGCCTTGGCCGACGGGGCTTTCAAGT
CGGTTGTCTATGGCAATGGAGGCCGTGGCAGCGAGGGCTGGTGTGTGCTTGTTGATGGGGAGAGGGCTCTGGCCG
ATGTGGGAAAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail