Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4611
Gene name
LocationContig_393:5365..8267
Strand-
Gene length (bp)2902
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00653 BIR Inhibitor of Apoptosis domain 3.8E-19 15 98
PF00653 BIR Inhibitor of Apoptosis domain 9.0E-22 124 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14064|BIR1_SCHPO Protein bir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bir1 PE=1 SV=1 8 199 1.0E-31
sp|A1E2V0|BIRC3_CANLF Baculoviral IAP repeat-containing protein 3 OS=Canis lupus familiaris GN=BIRC3 PE=2 SV=1 32 201 7.0E-17
sp|O62640|PIAP_PIG Putative inhibitor of apoptosis OS=Sus scrofa GN=PIAP PE=2 SV=1 27 201 3.0E-16
sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 30 201 8.0E-16
sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 27 201 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14064|BIR1_SCHPO Protein bir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bir1 PE=1 SV=1 8 199 1.0E-31
sp|A1E2V0|BIRC3_CANLF Baculoviral IAP repeat-containing protein 3 OS=Canis lupus familiaris GN=BIRC3 PE=2 SV=1 32 201 7.0E-17
sp|O62640|PIAP_PIG Putative inhibitor of apoptosis OS=Sus scrofa GN=PIAP PE=2 SV=1 27 201 3.0E-16
sp|Q13489|BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens GN=BIRC3 PE=1 SV=2 30 201 8.0E-16
sp|O08863|BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus GN=Birc3 PE=1 SV=2 27 201 2.0E-15
sp|Q13490|BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens GN=BIRC2 PE=1 SV=2 27 201 3.0E-15
sp|Q62210|BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus GN=Birc2 PE=1 SV=1 27 201 2.0E-14
sp|P47134|BIR1_YEAST Protein BIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BIR1 PE=1 SV=1 13 202 9.0E-14
sp|Q24307|DIAP2_DROME Death-associated inhibitor of apoptosis 2 OS=Drosophila melanogaster GN=Diap2 PE=1 SV=3 39 198 2.0E-13
sp|Q60989|XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus GN=Xiap PE=1 SV=2 32 197 6.0E-13
sp|Q9R0I6|XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus GN=Xiap PE=2 SV=1 32 197 8.0E-13
sp|P98170|XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens GN=XIAP PE=1 SV=2 5 197 3.0E-12
sp|A9JTP3|BIRC7_XENTR Baculoviral IAP repeat-containing protein 7 OS=Xenopus tropicalis GN=birc7 PE=2 SV=1 32 197 5.0E-12
sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus GN=ITA PE=2 SV=1 27 197 4.0E-11
sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 32 197 5.0E-11
sp|Q4R1J6|BI51B_XENLA Baculoviral IAP repeat-containing protein 5.1-B OS=Xenopus laevis GN=birc5.1-b PE=2 SV=1 119 198 2.0E-10
sp|P41436|IAP_GVCPM Apoptosis inhibitor IAP OS=Cydia pomonella granulosis virus (isolate Mexico/1963) GN=IAP PE=3 SV=1 39 198 2.0E-10
sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 32 197 3.0E-10
sp|A5D8Q0|XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis GN=xiap PE=2 SV=2 9 197 3.0E-10
sp|Q8JGN5|BI51A_XENLA Baculoviral IAP repeat-containing protein 5.1-A OS=Xenopus laevis GN=birc5.1-a PE=1 SV=1 119 198 1.0E-09
sp|O15392|BIRC5_HUMAN Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens GN=BIRC5 PE=1 SV=3 118 202 1.0E-09
sp|Q5RAH9|BIRC5_PONAB Baculoviral IAP repeat-containing protein 5 OS=Pongo abelii GN=BIRC5 PE=2 SV=1 118 202 1.0E-09
sp|Q8JGN5|BI51A_XENLA Baculoviral IAP repeat-containing protein 5.1-A OS=Xenopus laevis GN=birc5.1-a PE=1 SV=1 12 97 2.0E-09
sp|P41437|IAP3_NPVOP E3 ubiquitin-protein ligase IAP-3 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=IAP3 PE=1 SV=1 29 198 4.0E-09
sp|Q6I6F4|BIRC5_FELCA Baculoviral IAP repeat-containing protein 5 OS=Felis catus GN=BIRC5 PE=2 SV=1 119 202 5.0E-09
sp|Q4R1J6|BI51B_XENLA Baculoviral IAP repeat-containing protein 5.1-B OS=Xenopus laevis GN=birc5.1-b PE=2 SV=1 12 97 6.0E-09
sp|Q5BKL8|XIAP_XENTR E3 ubiquitin-protein ligase XIAP OS=Xenopus tropicalis GN=xiap PE=2 SV=1 9 197 6.0E-09
sp|Q8I009|BIRC5_CANLF Baculoviral IAP repeat-containing protein 5 OS=Canis lupus familiaris GN=BIRC5 PE=2 SV=2 119 202 7.0E-09
sp|Q9JHY7|BIRC5_RAT Baculoviral IAP repeat-containing protein 5 OS=Rattus norvegicus GN=Birc5 PE=2 SV=1 119 201 9.0E-09
sp|Q28ER3|BIR52_XENTR Baculoviral IAP repeat-containing protein 5.2 OS=Xenopus tropicalis GN=birc5.2 PE=2 SV=2 6 95 1.0E-08
sp|Q804H7|BI52B_XENLA Baculoviral IAP repeat-containing protein 5.2-B OS=Xenopus laevis GN=birc5.2-b PE=1 SV=2 25 95 2.0E-08
sp|Q9GLN5|BIRC5_PIG Baculoviral IAP repeat-containing protein 5 OS=Sus scrofa GN=BIRC5 PE=2 SV=1 115 202 2.0E-08
sp|Q28ER3|BIR52_XENTR Baculoviral IAP repeat-containing protein 5.2 OS=Xenopus tropicalis GN=birc5.2 PE=2 SV=2 114 199 2.0E-08
sp|Q50L39|BI52A_XENLA Baculoviral IAP repeat-containing protein 5.2-A OS=Xenopus laevis GN=birc5.2-a PE=1 SV=1 114 201 2.0E-08
sp|Q6J1J1|BIRC5_BOVIN Baculoviral IAP repeat-containing protein 5 OS=Bos taurus GN=BIRC5 PE=2 SV=2 119 202 3.0E-08
sp|Q804H7|BI52B_XENLA Baculoviral IAP repeat-containing protein 5.2-B OS=Xenopus laevis GN=birc5.2-b PE=1 SV=2 114 201 3.0E-08
sp|O70201|BIRC5_MOUSE Baculoviral IAP repeat-containing protein 5 OS=Mus musculus GN=Birc5 PE=1 SV=1 119 201 3.0E-08
sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2 107 195 3.0E-08
sp|Q6J1J1|BIRC5_BOVIN Baculoviral IAP repeat-containing protein 5 OS=Bos taurus GN=BIRC5 PE=2 SV=2 32 100 4.0E-08
sp|O15392|BIRC5_HUMAN Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens GN=BIRC5 PE=1 SV=3 32 100 5.0E-08
sp|O88738|BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus GN=Birc6 PE=1 SV=2 107 195 5.0E-08
sp|Q9GLN5|BIRC5_PIG Baculoviral IAP repeat-containing protein 5 OS=Sus scrofa GN=BIRC5 PE=2 SV=1 32 100 5.0E-08
sp|Q5RAH9|BIRC5_PONAB Baculoviral IAP repeat-containing protein 5 OS=Pongo abelii GN=BIRC5 PE=2 SV=1 32 100 5.0E-08
sp|Q6I6F4|BIRC5_FELCA Baculoviral IAP repeat-containing protein 5 OS=Felis catus GN=BIRC5 PE=2 SV=1 32 100 7.0E-08
sp|Q28H51|BIR51_XENTR Baculoviral IAP repeat-containing protein 5.1 OS=Xenopus tropicalis GN=birc5.1 PE=2 SV=1 119 198 7.0E-08
sp|Q28H51|BIR51_XENTR Baculoviral IAP repeat-containing protein 5.1 OS=Xenopus tropicalis GN=birc5.1 PE=2 SV=1 12 97 8.0E-08
sp|Q50L39|BI52A_XENLA Baculoviral IAP repeat-containing protein 5.2-A OS=Xenopus laevis GN=birc5.2-a PE=1 SV=1 31 95 9.0E-08
sp|Q8I009|BIRC5_CANLF Baculoviral IAP repeat-containing protein 5 OS=Canis lupus familiaris GN=BIRC5 PE=2 SV=2 32 100 1.0E-07
sp|Q9JHY7|BIRC5_RAT Baculoviral IAP repeat-containing protein 5 OS=Rattus norvegicus GN=Birc5 PE=2 SV=1 32 100 2.0E-07
sp|Q13075|BIRC1_HUMAN Baculoviral IAP repeat-containing protein 1 OS=Homo sapiens GN=NAIP PE=1 SV=3 40 196 2.0E-07
sp|O70201|BIRC5_MOUSE Baculoviral IAP repeat-containing protein 5 OS=Mus musculus GN=Birc5 PE=1 SV=1 30 100 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2948
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4611 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2206
Ophiocordyceps camponoti-floridani Ophcf2|02822
Ophiocordyceps camponoti-rufipedis Ophun1|6171
Ophiocordyceps kimflemingae Ophio5|6969
Ophiocordyceps subramaniannii Hirsu2|4972

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4611
MVAANPDQYMTYEARLASFQKPKKRGSTANTRTKAAAGWPHKFISPQSLASAGFYFDPSPSAPDKVSCFLCRNDL
DGWESGDDALLEHLTHASNCGWAIVAAIQAQVGDYGSEDPDMPYMVEARKATFDGRWPHEGKKGWKCKTKQLVEA
GWKFTPTLESDDMATCVYCDLALDGWERGDKPYDEHHRRSPNCTFFLLKAQFGGGQKKTAPSRPIRGSKASRLST
QSVGTLADTTANIDDSVVTTASTMAPRSKTNKATTAKGSRRKPNKTDLDEQQQEKASQPPARGIRGKKRANDALD
DSTMLSEKPAPKKRAVRTRASTATDPSTALAHDSDVSDAYTQPRSMSATRPNVHADRQPSAVSTISTASIASLRG
LPDSFPDDEEIERQLEQDLDKEWTEDDEAIPQHHDHDQDQELEVHHQVEKSAFYRMLDPEAIQVDDVAVNEELEA
LKMEMEVDAQKPSTLYKKQTPAARKLSSQSRATKVKVISPCSEAATSQDGDDDAPEYPLQEALDQAEEESLQSTG
TVVKVAAEPVQMDSADPDELGHARLSQASSRASGQEQTQALAATQKGRLSKTSLTSCRQSQEKEPRRGPGRPSKA
SLSRQHSLAQNGAPAAEVPLKRGRGRPPKTSTASQQSVADEHVAKEQAVKRSRGRPRKTSEDDAQGLEQAGAARE
PCKSQDIKDAGDGLSKRGRGRRPKSRETDASHTQEVASVPDGLDAVVVVHEDETSTKERTPPQGLAARDGDAAKQ
KSAAFLSTPSKPSAAASAPDSPQQSSDAENHPPSSKPAASSTRSTTQTVPVASTPPPPSKRTMLAGLHSSTPWTA
INLDSIFGTPRLTVSKEEAVRTLLRQGDELASPEKGMTVEEWMLNNARQAEEGLRHECEVMVNGFERQGARAMHV
LEGISTE*
Coding >OphauG2|4611
ATGGTGGCCGCCAACCCCGACCAGTACATGACATACGAGGCTCGTCTTGCCTCGTTTCAAAAACCCAAAAAGCGA
GGCTCCACGGCCAACACGCGGACCAAGGCTGCTGCTGGCTGGCCACACAAATTCATCTCGCCCCAAAGCCTCGCC
AGCGCCGGCTTCTACTTTGATCCCAGCCCCAGCGCCCCCGACAAAGTCTCGTGCTTCCTCTGCCGCAACGACCTC
GACGGCTGGGAGTCGGGCGACGATGCGCTCCTGGAGCATCTCACCCACGCCTCAAACTGCGGCTGGGCCATTGTC
GCTGCAATCCAGGCCCAAGTCGGCGACTATGGCAGCGAGGACCCTGACATGCCCTACATGGTGGAGGCGCGCAAG
GCAACCTTTGATGGCCGCTGGCCCCATGAAGGCAAGAAGGGCTGGAAGTGCAAGACAAAGCAGCTTGTTGAGGCC
GGCTGGAAATTTACACCCACTCTCGAGTCGGACGACATGGCAACCTGCGTCTACTGTGACCTCGCTCTTGACGGC
TGGGAACGTGGCGACAAGCCCTACGACGAACATCATCGCCGATCCCCCAACTGTACCTTTTTTCTCCTCAAAGCC
CAGTTTGGAGGTGGACAAAAGAAGACTGCGCCAAGCAGACCCATTCGTGGCTCCAAGGCATCCCGCCTCTCGACT
CAGTCGGTCGGCACCTTGGCCGACACTACAGCCAATATCGATGACAGTGTCGTGACTACTGCTTCCACAATGGCA
CCTCGATCCAAGACCAACAAGGCCACTACCGCCAAGGGTAGCCGAAGAAAACCCAACAAGACAGACCTTGATGAG
CAGCAGCAAGAAAAGGCTTCGCAGCCGCCTGCAAGGGGAATCCGTGGCAAGAAACGAGCCAATGACGCTCTCGAC
GATTCCACCATGTTGTCCGAAAAACCGGCACCCAAAAAACGAGCTGTTCGAACTCGCGCTAGTACTGCGACGGAT
CCCTCGACTGCCCTGGCCCATGATAGTGACGTGTCGGACGCATATACACAGCCGCGTAGCATGTCGGCTACAAGG
CCAAACGTACACGCCGATAGGCAGCCCTCGGCCGTTTCAACAATTTCGACAGCCTCGATTGCATCGCTCAGAGGT
CTGCCAGACTCTTTCCCCGACGATGAAGAGATTGAGCGTCAACTGGAGCAAGATTTGGACAAGGAATGGACCGAG
GACGACGAGGCCATTCCCCAGCACCATGACCATGACCAAGACCAAGAGCTTGAGGTGCATCATCAAGTCGAGAAA
TCGGCCTTTTACCGCATGTTGGATCCTGAAGCTATTCAAGTCGATGACGTTGCTGTCAATGAGGAGCTTGAGGCA
CTAAAAATGGAGATGGAGGTTGATGCACAGAAGCCCTCTACACTATACAAGAAGCAGACACCAGCGGCTCGCAAG
TTGTCGAGCCAATCTCGAGCCACCAAAGTCAAGGTTATATCGCCTTGCAGCGAAGCGGCGACTAGCCAAGACGGA
GACGACGATGCCCCTGAGTATCCTCTTCAAGAAGCCCTGGACCAAGCGGAGGAGGAAAGTCTTCAAAGCACCGGC
ACCGTGGTTAAAGTAGCTGCCGAGCCGGTGCAAATGGACTCTGCTGACCCAGATGAACTTGGTCATGCCAGGCTG
TCACAGGCCTCTAGCAGAGCATCTGGCCAAGAGCAAACGCAAGCTTTAGCAGCGACACAAAAGGGACGTCTTTCC
AAGACGTCACTGACATCATGTCGGCAGTCTCAAGAGAAAGAGCCTAGAAGAGGGCCAGGCCGCCCATCTAAAGCT
TCCCTGTCACGGCAGCATTCATTGGCCCAAAATGGTGCTCCAGCGGCAGAAGTGCCGTTGAAACGAGGACGCGGC
CGCCCACCCAAAACATCGACGGCTTCTCAACAGTCAGTGGCGGATGAGCACGTGGCTAAAGAACAGGCTGTCAAG
CGAAGTCGTGGCCGTCCTCGCAAGACATCTGAAGATGATGCCCAAGGTCTGGAGCAGGCAGGTGCCGCAAGAGAG
CCTTGCAAGTCTCAGGACATCAAAGACGCAGGTGATGGGCTCTCGAAGCGCGGCCGAGGACGACGGCCCAAGAGT
AGGGAAACTGATGCATCTCACACGCAAGAGGTAGCCTCTGTGCCTGATGGGCTGGATGCAGTTGTGGTTGTGCAC
GAGGATGAGACATCGACAAAGGAGCGCACGCCGCCTCAAGGACTAGCAGCCCGTGATGGAGACGCCGCAAAGCAG
AAATCTGCAGCGTTTCTTTCAACGCCGTCAAAGCCTTCAGCCGCCGCCAGCGCACCCGACTCGCCACAGCAGTCG
TCCGACGCCGAGAACCACCCGCCCTCCTCCAAGCCGGCGGCCAGCTCGACTCGCTCCACGACACAGACGGTGCCC
GTGGCTTCGACGCCGCCGCCGCCATCGAAGCGCACTATGCTGGCAGGCCTACATAGCTCGACGCCCTGGACAGCT
ATCAACCTCGACTCCATCTTTGGCACGCCGCGCTTGACAGTGAGCAAGGAGGAGGCGGTGCGGACGCTGCTTCGC
CAGGGCGACGAGCTGGCAAGTCCGGAAAAGGGCATGACGGTTGAGGAGTGGATGCTGAACAACGCGCGTCAGGCC
GAAGAGGGCCTCCGCCACGAATGCGAAGTCATGGTGAATGGCTTTGAGCGCCAGGGTGCGCGCGCCATGCATGTA
CTGGAGGGCATTTCTACCGAGTAG
Transcript >OphauG2|4611
ATGGTGGCCGCCAACCCCGACCAGTACATGACATACGAGGCTCGTCTTGCCTCGTTTCAAAAACCCAAAAAGCGA
GGCTCCACGGCCAACACGCGGACCAAGGCTGCTGCTGGCTGGCCACACAAATTCATCTCGCCCCAAAGCCTCGCC
AGCGCCGGCTTCTACTTTGATCCCAGCCCCAGCGCCCCCGACAAAGTCTCGTGCTTCCTCTGCCGCAACGACCTC
GACGGCTGGGAGTCGGGCGACGATGCGCTCCTGGAGCATCTCACCCACGCCTCAAACTGCGGCTGGGCCATTGTC
GCTGCAATCCAGGCCCAAGTCGGCGACTATGGCAGCGAGGACCCTGACATGCCCTACATGGTGGAGGCGCGCAAG
GCAACCTTTGATGGCCGCTGGCCCCATGAAGGCAAGAAGGGCTGGAAGTGCAAGACAAAGCAGCTTGTTGAGGCC
GGCTGGAAATTTACACCCACTCTCGAGTCGGACGACATGGCAACCTGCGTCTACTGTGACCTCGCTCTTGACGGC
TGGGAACGTGGCGACAAGCCCTACGACGAACATCATCGCCGATCCCCCAACTGTACCTTTTTTCTCCTCAAAGCC
CAGTTTGGAGGTGGACAAAAGAAGACTGCGCCAAGCAGACCCATTCGTGGCTCCAAGGCATCCCGCCTCTCGACT
CAGTCGGTCGGCACCTTGGCCGACACTACAGCCAATATCGATGACAGTGTCGTGACTACTGCTTCCACAATGGCA
CCTCGATCCAAGACCAACAAGGCCACTACCGCCAAGGGTAGCCGAAGAAAACCCAACAAGACAGACCTTGATGAG
CAGCAGCAAGAAAAGGCTTCGCAGCCGCCTGCAAGGGGAATCCGTGGCAAGAAACGAGCCAATGACGCTCTCGAC
GATTCCACCATGTTGTCCGAAAAACCGGCACCCAAAAAACGAGCTGTTCGAACTCGCGCTAGTACTGCGACGGAT
CCCTCGACTGCCCTGGCCCATGATAGTGACGTGTCGGACGCATATACACAGCCGCGTAGCATGTCGGCTACAAGG
CCAAACGTACACGCCGATAGGCAGCCCTCGGCCGTTTCAACAATTTCGACAGCCTCGATTGCATCGCTCAGAGGT
CTGCCAGACTCTTTCCCCGACGATGAAGAGATTGAGCGTCAACTGGAGCAAGATTTGGACAAGGAATGGACCGAG
GACGACGAGGCCATTCCCCAGCACCATGACCATGACCAAGACCAAGAGCTTGAGGTGCATCATCAAGTCGAGAAA
TCGGCCTTTTACCGCATGTTGGATCCTGAAGCTATTCAAGTCGATGACGTTGCTGTCAATGAGGAGCTTGAGGCA
CTAAAAATGGAGATGGAGGTTGATGCACAGAAGCCCTCTACACTATACAAGAAGCAGACACCAGCGGCTCGCAAG
TTGTCGAGCCAATCTCGAGCCACCAAAGTCAAGGTTATATCGCCTTGCAGCGAAGCGGCGACTAGCCAAGACGGA
GACGACGATGCCCCTGAGTATCCTCTTCAAGAAGCCCTGGACCAAGCGGAGGAGGAAAGTCTTCAAAGCACCGGC
ACCGTGGTTAAAGTAGCTGCCGAGCCGGTGCAAATGGACTCTGCTGACCCAGATGAACTTGGTCATGCCAGGCTG
TCACAGGCCTCTAGCAGAGCATCTGGCCAAGAGCAAACGCAAGCTTTAGCAGCGACACAAAAGGGACGTCTTTCC
AAGACGTCACTGACATCATGTCGGCAGTCTCAAGAGAAAGAGCCTAGAAGAGGGCCAGGCCGCCCATCTAAAGCT
TCCCTGTCACGGCAGCATTCATTGGCCCAAAATGGTGCTCCAGCGGCAGAAGTGCCGTTGAAACGAGGACGCGGC
CGCCCACCCAAAACATCGACGGCTTCTCAACAGTCAGTGGCGGATGAGCACGTGGCTAAAGAACAGGCTGTCAAG
CGAAGTCGTGGCCGTCCTCGCAAGACATCTGAAGATGATGCCCAAGGTCTGGAGCAGGCAGGTGCCGCAAGAGAG
CCTTGCAAGTCTCAGGACATCAAAGACGCAGGTGATGGGCTCTCGAAGCGCGGCCGAGGACGACGGCCCAAGAGT
AGGGAAACTGATGCATCTCACACGCAAGAGGTAGCCTCTGTGCCTGATGGGCTGGATGCAGTTGTGGTTGTGCAC
GAGGATGAGACATCGACAAAGGAGCGCACGCCGCCTCAAGGACTAGCAGCCCGTGATGGAGACGCCGCAAAGCAG
AAATCTGCAGCGTTTCTTTCAACGCCGTCAAAGCCTTCAGCCGCCGCCAGCGCACCCGACTCGCCACAGCAGTCG
TCCGACGCCGAGAACCACCCGCCCTCCTCCAAGCCGGCGGCCAGCTCGACTCGCTCCACGACACAGACGGTGCCC
GTGGCTTCGACGCCGCCGCCGCCATCGAAGCGCACTATGCTGGCAGGCCTACATAGCTCGACGCCCTGGACAGCT
ATCAACCTCGACTCCATCTTTGGCACGCCGCGCTTGACAGTGAGCAAGGAGGAGGCGGTGCGGACGCTGCTTCGC
CAGGGCGACGAGCTGGCAAGTCCGGAAAAGGGCATGACGGTTGAGGAGTGGATGCTGAACAACGCGCGTCAGGCC
GAAGAGGGCCTCCGCCACGAATGCGAAGTCATGGTGAATGGCTTTGAGCGCCAGGGTGCGCGCGCCATGCATGTA
CTGGAGGGCATTTCTACCGAGTAG
Gene >OphauG2|4611
ATGGTGGCCGCCAACCCCGACCAGTACATGACATACGAGGCTCGTCTTGCCTCGTTTCAAAAACCCAAAAAGCGA
GGCTCCACGGCCAACACGCGGACCAAGGCTGCTGCTGGCTGGCCACACAAATTCATCTCGCCCCAAAGCGCAAGT
TTGTCTGCTCGGTGCACCCAGTCCATGGCTAACTGACACGCCCAATAGCTCGCCAGCGCCGGCTTCTACTTTGAT
CCCAGCCCCAGCGCCCCCGACAAAGTCTCGTGCTTCCTCTGCCGCAACGACCTCGACGGCTGGGAGTCGGGCGAC
GATGCGCTCCTGGAGCATCTCACCCACGCCTCAAACTGCGGCTGGGCCATTGTCGCTGCAATCCAGGCCCAAGTC
GGCGACTATGGCAGCGAGGACCCTGACATGCCCTACATGGTGGAGGCGCGCAAGGCAACCTTTGATGGCCGCTGG
CCCCATGAAGGCAAGAAGGGCTGGAAGTGCAAGACAAAGCAGGCAAGTCTGTCCCATGCACTAGCCCCAGCAGCT
TTCGTCTTCTGACGCCCGAATCCACGCTCAGCTTGTTGAGGCCGGCTGGAAATTTACACCCACTCTCGAGTCGGA
CGACATGGCAACCTGCGTCTACTGTGACCTCGCTCTTGACGGCTGGGAACGTGGCGACAAGCCCTAGTGAGTGCA
CTCTGTTGTGTCGGTCGCGTAGCCTTGCTGCTGTCTGACTTATGCAAAAAGCGACGAACATCATCGCCGATCCCC
CAACTGTACCTTTTTTCTCCTCAAAGCCCAGTTTGGAGGTGGACAAAAGAAGACTGCGCCAAGCAGACCCATTCG
TGGCTCCAAGGCATCCCGCCTCTCGACTCAGTCGGTCGGCACCTTGGCCGACACTACAGCCAATATCGATGACAG
TGTCGTGACTACTGCTTCCACAATGGCACCTCGATCCAAGACCAACAAGGCCACTACCGCCAAGGGTAGCCGAAG
AAAACCCAACAAGACAGACCTTGATGAGCAGCAGCAAGAAAAGGCTTCGCAGCCGCCTGCAAGGGGAATCCGTGG
CAAGAAACGAGCCAATGACGCTCTCGACGATTCCACCATGTTGTCCGAAAAACCGGCACCCAAAAAACGAGCTGT
TCGAACTCGCGCTAGTACTGCGACGGATCCCTCGACTGCCCTGGCCCATGATAGTGACGTGTCGGACGCATATAC
ACAGCCGCGTAGCATGTCGGCTACAAGGCCAAACGTACACGCCGATAGGCAGCCCTCGGCCGTTTCAACAATTTC
GACAGCCTCGATTGCATCGCTCAGAGGTCTGCCAGACTCTTTCCCCGACGATGAAGAGATTGAGCGTCAACTGGA
GCAAGATTTGGACAAGGAATGGACCGAGGACGACGAGGCCATTCCCCAGCACCATGACCATGACCAAGACCAAGA
GCTTGAGGTGCATCATCAAGTCGAGAAATCGGCCTTTTACCGCATGTTGGATCCTGAAGCTATTCAAGTCGATGA
CGTTGCTGTCAATGAGGAGCTTGAGGCACTAAAAATGGAGATGGAGGTTGATGCACAGAAGCCCTCTACACTATA
CAAGAAGCAGACACCAGCGGCTCGCAAGTTGTCGAGCCAATCTCGAGCCACCAAAGTCAAGGTTATATCGCCTTG
CAGCGAAGCGGCGACTAGCCAAGACGGAGACGACGATGCCCCTGAGTATCCTCTTCAAGAAGCCCTGGACCAAGC
GGAGGAGGAAAGTCTTCAAAGCACCGGCACCGTGGTTAAAGTAGCTGCCGAGCCGGTGCAAATGGACTCTGCTGA
CCCAGATGAACTTGGTCATGCCAGGCTGTCACAGGCCTCTAGCAGAGCATCTGGCCAAGAGCAAACGCAAGCTTT
AGCAGCGACACAAAAGGGACGTCTTTCCAAGACGTCACTGACATCATGTCGGCAGTCTCAAGAGAAAGAGCCTAG
AAGAGGGCCAGGCCGCCCATCTAAAGCTTCCCTGTCACGGCAGCATTCATTGGCCCAAAATGGTGCTCCAGCGGC
AGAAGTGCCGTTGAAACGAGGACGCGGCCGCCCACCCAAAACATCGACGGCTTCTCAACAGTCAGTGGCGGATGA
GCACGTGGCTAAAGAACAGGCTGTCAAGCGAAGTCGTGGCCGTCCTCGCAAGACATCTGAAGATGATGCCCAAGG
TCTGGAGCAGGCAGGTGCCGCAAGAGAGCCTTGCAAGTCTCAGGACATCAAAGACGCAGGTGATGGGCTCTCGAA
GCGCGGCCGAGGACGACGGCCCAAGAGTAGGGAAACTGATGCATCTCACACGCAAGAGGTAGCCTCTGTGCCTGA
TGGGCTGGATGCAGTTGTGGTTGTGCACGAGGATGAGACATCGACAAAGGAGCGCACGCCGCCTCAAGGACTAGC
AGCCCGTGATGGAGACGCCGCAAAGCAGAAATCTGCAGCGTTTCTTTCAACGCCGTCAAAGCCTTCAGCCGCCGC
CAGCGCACCCGACTCGCCACAGCAGTCGTCCGACGCCGAGAACCACCCGCCCTCCTCCAAGCCGGCGGCCAGCTC
GACTCGCTCCACGACACAGACGGTGCCCGTGGCTTCGACGCCGCCGCCGCCATCGAAGCGCACTATGCTGGCAGG
CCTACATAGCTCGACGCCCTGGACAGCTATCAACCTCGACTCCATCTTTGGCACGCCGCGCTTGACAGTGAGCAA
GGAGGAGGCGGTGCGGACGCTGCTTCGCCAGGGCGACGAGCTGGCAAGTCCGGAAAAGGGCATGACGGTTGAGGA
GTGGATGCTGAACAACGCGCGTCAGGCCGAAGAGGGCCTCCGCCACGAATGCGAAGTCATGGTGAATGGCTTTGA
GCGCCAGGGTGCGCGCGCCATGCATGTACTGGAGGGCATTTCTACCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail