Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4609
Gene name
LocationContig_392:14743..15590
Strand+
Gene length (bp)847
Transcript length (bp)606
Coding sequence length (bp)606
Protein length (aa) 202

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99956

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4518
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4609 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5460
Ophiocordyceps camponoti-floridani Ophcf2|04650
Ophiocordyceps camponoti-rufipedis Ophun1|3820
Ophiocordyceps kimflemingae Ophio5|5344
Ophiocordyceps subramaniannii Hirsu2|944

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4609
MRVSNTLCLVATTVVSAQSSQSRHNYTSELDMKIDPNSVSTQQRAVWCQAQTNTCGLLCDNNTGKNACSQEDLGF
ECTCASNSSIPGLQYYTQTMPTFICETLFSQCNMENVGNADGQKACTTNIRDLCGTNPPPKAPVSSDDHGDGDND
SKASGSSGPAASGTGGNAVVSTTSGGLAPTMVPGSNGAVAAAALGFLAYLV*
Coding >OphauG2|4609
ATGCGCGTCTCTAATACGCTTTGTCTCGTTGCCACTACTGTGGTTTCGGCCCAGTCGTCGCAGTCGAGACACAAT
TACACGAGCGAACTCGACATGAAGATTGATCCCAACTCGGTGTCGACTCAGCAGCGAGCTGTTTGGTGCCAGGCC
CAGACGAATACCTGTGGTCTCCTTTGCGACAATAACACTGGCAAGAACGCTTGTTCTCAGGAGGATCTTGGCTTC
GAGTGCACCTGTGCCTCGAATAGCTCAATCCCTGGTTTGCAGTACTACACGCAGACGATGCCAACATTCATCTGC
GAAACGCTCTTCAGCCAGTGCAACATGGAAAACGTGGGCAACGCCGACGGGCAAAAGGCATGCACGACTAACATT
CGTGACCTTTGCGGCACCAACCCGCCACCCAAGGCGCCCGTCAGCAGCGACGACCATGGCGATGGCGACAACGAC
TCTAAGGCGTCGGGCTCGTCTGGGCCAGCGGCCTCTGGTACGGGCGGAAACGCTGTCGTTTCGACGACTTCTGGT
GGCTTAGCTCCCACCATGGTACCCGGTTCCAATGGTGCAGTGGCTGCTGCTGCTTTGGGCTTTCTGGCTTATCTC
GTCTAA
Transcript >OphauG2|4609
ATGCGCGTCTCTAATACGCTTTGTCTCGTTGCCACTACTGTGGTTTCGGCCCAGTCGTCGCAGTCGAGACACAAT
TACACGAGCGAACTCGACATGAAGATTGATCCCAACTCGGTGTCGACTCAGCAGCGAGCTGTTTGGTGCCAGGCC
CAGACGAATACCTGTGGTCTCCTTTGCGACAATAACACTGGCAAGAACGCTTGTTCTCAGGAGGATCTTGGCTTC
GAGTGCACCTGTGCCTCGAATAGCTCAATCCCTGGTTTGCAGTACTACACGCAGACGATGCCAACATTCATCTGC
GAAACGCTCTTCAGCCAGTGCAACATGGAAAACGTGGGCAACGCCGACGGGCAAAAGGCATGCACGACTAACATT
CGTGACCTTTGCGGCACCAACCCGCCACCCAAGGCGCCCGTCAGCAGCGACGACCATGGCGATGGCGACAACGAC
TCTAAGGCGTCGGGCTCGTCTGGGCCAGCGGCCTCTGGTACGGGCGGAAACGCTGTCGTTTCGACGACTTCTGGT
GGCTTAGCTCCCACCATGGTACCCGGTTCCAATGGTGCAGTGGCTGCTGCTGCTTTGGGCTTTCTGGCTTATCTC
GTCTAA
Gene >OphauG2|4609
ATGCGCGTCTCTAATACGCTTTGTCTCGTTGCCACTACTGTGGTTTCGGCCCAGTCGTCGCAGTCGAGACACAAT
TACACGAGCGAACTCGACATGAAGATTGATCCCAACTCGGTGTCGACTCAGCAGCGAGGTATGACTTGTCAATTG
GCGGTAGCGCCTTGGCTCGACACGGCGGTCTGGGGGCGGCCTGTCTATGCAAAGCCCAACCCCCAAACCCCAAAC
CCCAAACCCCAAACCCCAAACCCCAAAAAAGGCCTTCGCAGAAATGTTTGCTAATGCCCCAATTTTTGGCAGCTG
TTTGGTGCCAGGCCCAGACGAATACCTGTGGTCTCCTTTGCGACAATAACACTGGCAAGAACGCTTGTTCTCAGG
TAAGCTTTTGCCTAGCTTGTTTAGGATTTCTTTGTGTAGCTGTAAAGCGTTGGGAAACTAACCGTAATGGTGATA
GGAGGATCTTGGCTTCGAGTGCACCTGTGCCTCGAATAGCTCAATCCCTGGTTTGCAGTACTACACGCAGACGAT
GCCAACATTCATCTGCGAAACGCTCTTCAGCCAGTGCAACATGGAAAACGTGGGCAACGCCGACGGGCAAAAGGC
ATGCACGACTAACATTCGTGACCTTTGCGGCACCAACCCGCCACCCAAGGCGCCCGTCAGCAGCGACGACCATGG
CGATGGCGACAACGACTCTAAGGCGTCGGGCTCGTCTGGGCCAGCGGCCTCTGGTACGGGCGGAAACGCTGTCGT
TTCGACGACTTCTGGTGGCTTAGCTCCCACCATGGTACCCGGTTCCAATGGTGCAGTGGCTGCTGCTGCTTTGGG
CTTTCTGGCTTATCTCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail