Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4605
Gene name
LocationContig_392:4919..5942
Strand+
Gene length (bp)1023
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 2.2E-42 35 238

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG1|RPF2_SCHPO Ribosome production factor 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.08c PE=1 SV=1 1 299 1.0E-93
sp|P36160|RPF2_YEAST Ribosome biogenesis protein RPF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF2 PE=1 SV=1 1 296 1.0E-91
sp|Q9JJ80|RPF2_MOUSE Ribosome production factor 2 homolog OS=Mus musculus GN=Rpf2 PE=2 SV=2 5 316 3.0E-72
sp|Q9H7B2|RPF2_HUMAN Ribosome production factor 2 homolog OS=Homo sapiens GN=RPF2 PE=1 SV=2 3 319 8.0E-71
sp|Q2YDN6|RPF2_BOVIN Ribosome production factor 2 homolog OS=Bos taurus GN=RPF2 PE=2 SV=1 3 297 5.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG1|RPF2_SCHPO Ribosome production factor 2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC926.08c PE=1 SV=1 1 299 1.0E-93
sp|P36160|RPF2_YEAST Ribosome biogenesis protein RPF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF2 PE=1 SV=1 1 296 1.0E-91
sp|Q9JJ80|RPF2_MOUSE Ribosome production factor 2 homolog OS=Mus musculus GN=Rpf2 PE=2 SV=2 5 316 3.0E-72
sp|Q9H7B2|RPF2_HUMAN Ribosome production factor 2 homolog OS=Homo sapiens GN=RPF2 PE=1 SV=2 3 319 8.0E-71
sp|Q2YDN6|RPF2_BOVIN Ribosome production factor 2 homolog OS=Bos taurus GN=RPF2 PE=2 SV=1 3 297 5.0E-69
sp|Q9VEB3|RPF2_DROME Ribosome production factor 2 homolog OS=Drosophila melanogaster GN=Non3 PE=2 SV=3 1 306 4.0E-62
sp|Q9N3F0|RPF2_CAEEL Ribosome production factor 2 homolog OS=Caenorhabditis elegans GN=Y54E10A.10 PE=3 SV=1 1 307 1.0E-57
sp|Q54DJ0|RPF2_DICDI Ribosome production factor 2 homolog OS=Dictyostelium discoideum GN=bxdc1 PE=3 SV=1 12 296 5.0E-51
sp|Q9AWM9|RPF2_ORYSJ Ribosome production factor 2 homolog OS=Oryza sativa subsp. japonica GN=Os01g0513800 PE=2 SV=1 7 297 2.0E-46
sp|Q9LUG5|RPF2_ARATH Ribosome production factor 2 homolog OS=Arabidopsis thaliana GN=At3g23620 PE=2 SV=1 1 301 8.0E-41
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0019843 rRNA binding Yes
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0016072 rRNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003723 RNA binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1220
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4605 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5456
Ophiocordyceps camponoti-floridani Ophcf2|04646
Ophiocordyceps camponoti-rufipedis Ophun1|3824
Ophiocordyceps kimflemingae Ophio5|5349
Ophiocordyceps subramaniannii Hirsu2|10390

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4605
MLRQVKPRNARSKRALEKREPKAVENPKTCLFLRGTSCSQIVQDALNELYSLRQPLAKKFSKKNAIHPFEDASSL
EFFAEKNDSSLLVFGSSQKKRPHALTFARTFGNRLLDMLELYLDPQSFRCMAQFKTKKVAIGLRPMLLFAGTPFE
SPVSNDYTLAKNLLLDFFKGDASSDQIDVEGLQYIISISAEDEVASDVDIKPPIRIRAYLIRTLRSGQKLPRVEV
EEMGPRMDLRLGRVKEPDESMLKEAMRKARGNEEKTKKNISTDTMGDKLGRVHLGRQDLSQLQTRKMKGLKRSIH
DDPEDKVSDSGAKNAKKPKVLP*
Coding >OphauG2|4605
ATGCTTCGCCAAGTTAAACCTCGCAATGCTCGCTCAAAGCGAGCTCTCGAGAAGCGCGAGCCCAAAGCCGTCGAG
AACCCCAAGACATGCCTCTTCCTGCGCGGCACCAGCTGCTCACAAATCGTCCAAGACGCACTCAACGAGCTATAC
TCCCTCCGACAACCCCTCGCCAAGAAGTTCTCAAAGAAAAATGCCATTCACCCGTTTGAAGACGCTTCTTCATTA
GAATTCTTTGCCGAAAAAAACGATTCCAGCCTGCTCGTCTTTGGCAGCAGCCAAAAGAAGCGCCCACACGCCCTG
ACGTTTGCCCGCACTTTTGGAAACCGCCTGCTTGACATGCTCGAACTCTACCTTGATCCGCAATCCTTTCGCTGT
ATGGCACAATTCAAGACCAAAAAGGTTGCCATCGGTCTGCGGCCAATGCTTCTCTTTGCCGGTACACCTTTTGAA
AGCCCCGTGAGCAACGACTATACCCTGGCAAAGAATCTACTCCTAGACTTTTTCAAAGGCGATGCCTCCTCGGAT
CAGATTGATGTGGAGGGCTTGCAATACATCATCTCTATTTCAGCCGAGGACGAGGTAGCTTCCGACGTCGATATC
AAGCCTCCCATTCGAATTCGCGCCTATCTTATTCGTACTCTACGCAGTGGTCAGAAGCTTCCTCGTGTCGAGGTT
GAAGAAATGGGTCCTCGCATGGATTTACGCCTTGGTCGCGTCAAAGAGCCCGATGAATCGATGCTCAAGGAAGCC
ATGCGCAAGGCCCGCGGCAATGAGGAAAAAACCAAGAAGAACATTTCAACCGATACCATGGGTGATAAGCTCGGT
CGTGTACATTTGGGAAGGCAGGACCTAAGTCAACTTCAGACGAGGAAGATGAAGGGTCTCAAGAGGTCAATACAT
GACGACCCCGAAGACAAAGTATCGGATTCTGGTGCAAAAAATGCCAAAAAACCCAAAGTTTTGCCATGA
Transcript >OphauG2|4605
ATGCTTCGCCAAGTTAAACCTCGCAATGCTCGCTCAAAGCGAGCTCTCGAGAAGCGCGAGCCCAAAGCCGTCGAG
AACCCCAAGACATGCCTCTTCCTGCGCGGCACCAGCTGCTCACAAATCGTCCAAGACGCACTCAACGAGCTATAC
TCCCTCCGACAACCCCTCGCCAAGAAGTTCTCAAAGAAAAATGCCATTCACCCGTTTGAAGACGCTTCTTCATTA
GAATTCTTTGCCGAAAAAAACGATTCCAGCCTGCTCGTCTTTGGCAGCAGCCAAAAGAAGCGCCCACACGCCCTG
ACGTTTGCCCGCACTTTTGGAAACCGCCTGCTTGACATGCTCGAACTCTACCTTGATCCGCAATCCTTTCGCTGT
ATGGCACAATTCAAGACCAAAAAGGTTGCCATCGGTCTGCGGCCAATGCTTCTCTTTGCCGGTACACCTTTTGAA
AGCCCCGTGAGCAACGACTATACCCTGGCAAAGAATCTACTCCTAGACTTTTTCAAAGGCGATGCCTCCTCGGAT
CAGATTGATGTGGAGGGCTTGCAATACATCATCTCTATTTCAGCCGAGGACGAGGTAGCTTCCGACGTCGATATC
AAGCCTCCCATTCGAATTCGCGCCTATCTTATTCGTACTCTACGCAGTGGTCAGAAGCTTCCTCGTGTCGAGGTT
GAAGAAATGGGTCCTCGCATGGATTTACGCCTTGGTCGCGTCAAAGAGCCCGATGAATCGATGCTCAAGGAAGCC
ATGCGCAAGGCCCGCGGCAATGAGGAAAAAACCAAGAAGAACATTTCAACCGATACCATGGGTGATAAGCTCGGT
CGTGTACATTTGGGAAGGCAGGACCTAAGTCAACTTCAGACGAGGAAGATGAAGGGTCTCAAGAGGTCAATACAT
GACGACCCCGAAGACAAAGTATCGGATTCTGGTGCAAAAAATGCCAAAAAACCCAAAGTTTTGCCATGA
Gene >OphauG2|4605
ATGCTTCGCCAAGTGTTAGTATACGTACTCTCCATACCTGAAAATCAAGCTTAAAATTTTCCCTATAGTAAACCT
CGCAATGCTCGCTCAAAGCGAGCTCTCGAGAAGCGCGAGCCCAAAGCCGTCGAGAACCCCAAGACATGCCTCTTC
CTGCGCGGCACCAGCTGCTCACAAATCGTCCAAGACGCACTCAACGAGCTATACTCCCTCCGACAACCCCTCGCC
AAGAAGTTCTCAAAGAAAAATGCCATTCACCCGTTTGAAGACGCTTCTTCATTAGAATTCTTTGCCGAAAAAAAC
GATTCCAGCCTGCTCGTCTTTGGCAGCAGCCAAAAGAAGCGCCCACACGCCCTGACGTTTGCCCGCACTTTTGGA
AACCGCCTGCTTGACATGCTCGAACTCTACCTTGATCCGCAATCCTTTCGCTGTATGGCACAATTCAAGACCAAA
AAGGTTGCCATCGGTCTGCGGCCAATGCTTCTCTTTGCCGGTACACCTTTTGAAAGCCCCGTGAGCAACGACTAT
ACCCTGGCAAAGAATCTACTCCTAGACTTTTTCAAAGGCGATGCCTCCTCGGATCAGATTGATGTGGAGGGCTTG
CAATACATCATCTCTATTTCAGCCGAGGACGAGGTAGCTTCCGACGTCGATATCAAGCCTCCCATTCGAATTCGC
GCCTATCTTATTCGTACTCTACGCAGTGGTCAGAAGCTTCCTCGTGTCGAGGTTGAAGAAATGGGTCCTCGCATG
GATTTACGCCTTGGTCGCGTCAAAGAGCCCGATGAATCGATGCTCAAGGAAGCCATGCGCAAGGCCCGCGGCAAT
GAGGAAAAAACCAAGAAGAACATTTCAACCGATACCATGGGTGATAAGCTCGGTCGTGTACATTTGGGAAGGCAG
GACCTAAGTCAACTTCAGACGAGGAAGATGAAGGGTCTCAAGAGGTCAATACATGACGACCCCGAAGACAAAGTA
TCGGATTCTGGTGCAAAAAATGCCAAAAAACCCAAAGTTTTGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail