Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4599
Gene name
LocationContig_391:3651..6842
Strand-
Gene length (bp)3191
Transcript length (bp)3006
Coding sequence length (bp)3006
Protein length (aa) 1002

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00493 MCM MCM P-loop domain 1.1E-98 569 791
PF17207 MCM_OB MCM OB domain 3.2E-40 374 502
PF17855 MCM_lid MCM AAA-lid domain 7.0E-27 811 898
PF14551 MCM_N MCM N-terminal domain 3.7E-18 208 314

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P29458|MCM4_SCHPO DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm4 PE=1 SV=2 95 970 0.0E+00
sp|P30665|MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM4 PE=1 SV=2 2 995 0.0E+00
sp|Q5JKB0|MCM4_ORYSJ DNA replication licensing factor MCM4 OS=Oryza sativa subsp. japonica GN=MCM4 PE=3 SV=2 195 992 0.0E+00
sp|Q0WVF5|MCM4_ARATH DNA replication licensing factor MCM4 OS=Arabidopsis thaliana GN=MCM4 PE=1 SV=1 363 992 0.0E+00
sp|P30664|MCM4B_XENLA DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-b PE=1 SV=3 195 991 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P29458|MCM4_SCHPO DNA replication licensing factor mcm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm4 PE=1 SV=2 95 970 0.0E+00
sp|P30665|MCM4_YEAST DNA replication licensing factor MCM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM4 PE=1 SV=2 2 995 0.0E+00
sp|Q5JKB0|MCM4_ORYSJ DNA replication licensing factor MCM4 OS=Oryza sativa subsp. japonica GN=MCM4 PE=3 SV=2 195 992 0.0E+00
sp|Q0WVF5|MCM4_ARATH DNA replication licensing factor MCM4 OS=Arabidopsis thaliana GN=MCM4 PE=1 SV=1 363 992 0.0E+00
sp|P30664|MCM4B_XENLA DNA replication licensing factor mcm4-B OS=Xenopus laevis GN=mcm4-b PE=1 SV=3 195 991 0.0E+00
sp|Q6GL41|MCM4_XENTR DNA replication licensing factor mcm4 OS=Xenopus tropicalis GN=mcm4 PE=2 SV=1 103 991 0.0E+00
sp|Q5XK83|MCM4A_XENLA DNA replication licensing factor mcm4-A OS=Xenopus laevis GN=mcm4-a PE=1 SV=1 195 991 0.0E+00
sp|P33991|MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5 195 991 0.0E+00
sp|P49717|MCM4_MOUSE DNA replication licensing factor MCM4 OS=Mus musculus GN=Mcm4 PE=1 SV=1 195 991 0.0E+00
sp|Q26454|MCM4_DROME DNA replication licensing factor MCM4 OS=Drosophila melanogaster GN=dpa PE=1 SV=2 15 992 0.0E+00
sp|P49736|MCM2_HUMAN DNA replication licensing factor MCM2 OS=Homo sapiens GN=MCM2 PE=1 SV=4 355 895 2.0E-108
sp|Q6DIH3|MCM2_XENTR DNA replication licensing factor mcm2 OS=Xenopus tropicalis GN=mcm2 PE=2 SV=1 363 895 1.0E-107
sp|P55861|MCM2_XENLA DNA replication licensing factor mcm2 OS=Xenopus laevis GN=mcm2 PE=1 SV=2 363 895 1.0E-107
sp|P55862|MCM5A_XENLA DNA replication licensing factor mcm5-A OS=Xenopus laevis GN=mcm5-a PE=1 SV=2 373 903 7.0E-107
sp|P43299|MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana GN=MCM7 PE=1 SV=2 210 950 2.0E-106
sp|P97310|MCM2_MOUSE DNA replication licensing factor MCM2 OS=Mus musculus GN=Mcm2 PE=1 SV=3 355 899 3.0E-106
sp|Q6PCI7|MCM5B_XENLA DNA replication licensing factor mcm5-B OS=Xenopus laevis GN=mcm5-b PE=2 SV=1 373 903 3.0E-106
sp|Q561P5|MCM5_XENTR DNA replication licensing factor mcm5 OS=Xenopus tropicalis GN=mcm5 PE=2 SV=1 373 903 5.0E-106
sp|P49735|MCM2_DROME DNA replication licensing factor Mcm2 OS=Drosophila melanogaster GN=Mcm2 PE=1 SV=1 363 895 7.0E-105
sp|P49718|MCM5_MOUSE DNA replication licensing factor MCM5 OS=Mus musculus GN=Mcm5 PE=1 SV=1 373 903 1.0E-104
sp|Q9UXG1|MCM_SULSO Minichromosome maintenance protein MCM OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=MCM PE=1 SV=1 363 934 1.0E-103
sp|Q0V8B7|MCM5_BOVIN DNA replication licensing factor MCM5 OS=Bos taurus GN=MCM5 PE=2 SV=1 373 903 2.0E-103
sp|F4KAB8|MCM6_ARATH DNA replication licensing factor MCM6 OS=Arabidopsis thaliana GN=MCM6 PE=1 SV=1 363 919 9.0E-103
sp|P33992|MCM5_HUMAN DNA replication licensing factor MCM5 OS=Homo sapiens GN=MCM5 PE=1 SV=5 373 903 1.0E-102
sp|O75001|MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm7 PE=1 SV=1 212 898 4.0E-102
sp|Q9VGW6|MCM5_DROME DNA replication licensing factor Mcm5 OS=Drosophila melanogaster GN=Mcm5 PE=1 SV=1 226 903 4.0E-102
sp|Q21902|MCM5_CAEEL DNA replication licensing factor mcm-5 OS=Caenorhabditis elegans GN=mcm-5 PE=3 SV=1 373 904 8.0E-102
sp|Q7Q0Q1|MCM6_ANOGA DNA replication licensing factor Mcm6 OS=Anopheles gambiae GN=Mcm6 PE=3 SV=3 368 907 3.0E-101
sp|Q28CM3|MCM6M_XENTR Maternal DNA replication licensing factor mcm6 OS=Xenopus tropicalis GN=mmcm6 PE=2 SV=1 368 899 3.0E-101
sp|P53091|MCM6_YEAST DNA replication licensing factor MCM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM6 PE=1 SV=2 320 899 6.0E-101
sp|Q0DHC4|MCM3_ORYSJ DNA replication licensing factor MCM3 OS=Oryza sativa subsp. japonica GN=MCM3 PE=2 SV=1 365 899 1.0E-100
sp|B8AZ99|MCM3_ORYSI DNA replication licensing factor MCM3 OS=Oryza sativa subsp. indica GN=MCM3 PE=3 SV=1 365 899 1.0E-100
sp|B8AZX3|MCM6_ORYSI DNA replication licensing factor MCM6 OS=Oryza sativa subsp. indica GN=MCM6 PE=3 SV=1 235 899 1.0E-100
sp|Q6F353|MCM6_ORYSJ DNA replication licensing factor MCM6 OS=Oryza sativa subsp. japonica GN=Os05g0235800 PE=3 SV=1 235 899 2.0E-100
sp|Q3ZBH9|MCM7_BOVIN DNA replication licensing factor MCM7 OS=Bos taurus GN=MCM7 PE=2 SV=1 374 956 2.0E-100
sp|Q43704|MCM31_MAIZE DNA replication licensing factor MCM3 homolog 1 OS=Zea mays GN=ROA1 PE=2 SV=2 365 899 3.0E-100
sp|P33993|MCM7_HUMAN DNA replication licensing factor MCM7 OS=Homo sapiens GN=MCM7 PE=1 SV=4 374 963 4.0E-100
sp|Q5FWY4|MCM6M_XENLA Maternal DNA replication licensing factor mcm6 OS=Xenopus laevis GN=mmcm6 PE=1 SV=1 368 899 4.0E-100
sp|P40377|MCM2_SCHPO DNA replication licensing factor mcm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm2 PE=1 SV=1 363 895 7.0E-100
sp|Q7ZY18|MC6ZB_XENLA Zygotic DNA replication licensing factor mcm6-B OS=Xenopus laevis GN=zmcm6-b PE=1 SV=1 368 899 1.0E-99
sp|Q6P1V8|MCM6Z_XENTR Zygotic DNA replication licensing factor mcm6 OS=Xenopus tropicalis GN=zmcm6 PE=2 SV=1 368 899 1.0E-99
sp|Q9SX03|MCM33_MAIZE DNA replication licensing factor MCM3 homolog 3 OS=Zea mays GN=ROA3 PE=2 SV=1 365 899 2.0E-99
sp|Q9SX04|MCM32_MAIZE DNA replication licensing factor MCM3 homolog 2 OS=Zea mays GN=ROA2 PE=2 SV=1 365 899 2.0E-99
sp|Q29JI9|MCM6_DROPS DNA replication licensing factor Mcm6 OS=Drosophila pseudoobscura pseudoobscura GN=Mcm6 PE=3 SV=1 368 907 3.0E-99
sp|Q9V461|MCM6_DROME DNA replication licensing factor Mcm6 OS=Drosophila melanogaster GN=Mcm6 PE=1 SV=1 368 899 4.0E-99
sp|Q6NX31|MCM7_XENTR DNA replication licensing factor mcm7 OS=Xenopus tropicalis GN=mcm7 PE=2 SV=1 345 963 4.0E-99
sp|Q498J7|MC6ZA_XENLA Zygotic DNA replication licensing factor mcm6-A OS=Xenopus laevis GN=zmcm6-a PE=1 SV=1 368 899 4.0E-99
sp|P97311|MCM6_MOUSE DNA replication licensing factor MCM6 OS=Mus musculus GN=Mcm6 PE=1 SV=1 368 899 7.0E-99
sp|Q91876|MCM7A_XENLA DNA replication licensing factor mcm7-A OS=Xenopus laevis GN=mcm7-a PE=1 SV=2 352 963 1.0E-98
sp|Q9LPD9|MCM2_ARATH DNA replication licensing factor MCM2 OS=Arabidopsis thaliana GN=MCM2 PE=1 SV=1 363 895 1.0E-98
sp|Q14566|MCM6_HUMAN DNA replication licensing factor MCM6 OS=Homo sapiens GN=MCM6 PE=1 SV=1 368 899 2.0E-98
sp|P29496|MCM5_YEAST Minichromosome maintenance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM5 PE=1 SV=1 243 904 2.0E-98
sp|Q2QNM1|MCM7_ORYSJ DNA replication licensing factor MCM7 OS=Oryza sativa subsp. japonica GN=MCM7 PE=2 SV=1 310 969 3.0E-98
sp|P49731|MCM6_SCHPO DNA replication licensing factor mcm6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm6 PE=1 SV=2 208 899 4.0E-98
sp|B8BMI1|MCM7_ORYSI DNA replication licensing factor MCM7 OS=Oryza sativa subsp. indica GN=MCM7 PE=3 SV=1 310 969 4.0E-98
sp|Q2R482|MCM2_ORYSJ DNA replication licensing factor MCM2 OS=Oryza sativa subsp. japonica GN=MCM2 PE=2 SV=1 363 895 4.0E-98
sp|Q9FL33|MCM3_ARATH DNA replication licensing factor MCM3 OS=Arabidopsis thaliana GN=MCM3 PE=1 SV=1 366 899 9.0E-98
sp|B8BKI8|MCM2_ORYSI DNA replication licensing factor MCM2 OS=Oryza sativa subsp. indica GN=OsI_36121 PE=3 SV=1 363 895 1.0E-97
sp|Q7ZXB1|MCM7B_XENLA DNA replication licensing factor mcm7-B OS=Xenopus laevis GN=mcm7-b PE=2 SV=1 352 963 2.0E-97
sp|Q2KIZ8|MCM6_BOVIN DNA replication licensing factor MCM6 OS=Bos taurus GN=MCM6 PE=2 SV=1 368 899 4.0E-97
sp|P41389|MCM5_SCHPO DNA replication licensing factor mcm5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm5 PE=1 SV=2 243 906 2.0E-96
sp|O80786|MCM5_ARATH DNA replication licensing factor MCM5 OS=Arabidopsis thaliana GN=MCM5 PE=1 SV=1 372 903 2.0E-95
sp|Q61881|MCM7_MOUSE DNA replication licensing factor MCM7 OS=Mus musculus GN=Mcm7 PE=1 SV=1 350 956 7.0E-94
sp|B8AEH3|MCM5_ORYSI DNA replication licensing factor MCM5 OS=Oryza sativa subsp. indica GN=MCM5 PE=3 SV=1 372 903 3.0E-93
sp|Q6KAJ4|MCM5_ORYSJ DNA replication licensing factor MCM5 OS=Oryza sativa subsp. japonica GN=MCM5 PE=2 SV=1 372 903 3.0E-93
sp|P29469|MCM2_YEAST DNA replication licensing factor MCM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM2 PE=1 SV=2 363 895 3.0E-92
sp|Q86B14|MCM6_DICDI DNA replication licensing factor mcm6 OS=Dictyostelium discoideum GN=mcm6 PE=3 SV=1 366 905 1.0E-91
sp|P38132|MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM7 PE=1 SV=4 370 898 9.0E-91
sp|Q54CP4|MCM5_DICDI DNA replication licensing factor mcm5 OS=Dictyostelium discoideum GN=mcm5 PE=3 SV=1 374 953 6.0E-90
sp|P49739|MCM3M_XENLA Maternal DNA replication licensing factor mcm3 OS=Xenopus laevis GN=mmcm3 PE=1 SV=2 366 898 1.0E-89
sp|P30666|MCM3_SCHPO DNA replication licensing factor mcm3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcm3 PE=1 SV=2 237 899 1.0E-89
sp|Q5F310|MCM8_XENLA DNA helicase MCM8 OS=Xenopus laevis GN=mcm8 PE=2 SV=2 358 937 6.0E-89
sp|D3ZVK1|MCM8_RAT DNA helicase MCM8 OS=Rattus norvegicus GN=Mcm8 PE=3 SV=1 358 987 9.0E-89
sp|Q0V9Q6|MCM8_XENTR DNA helicase MCM8 OS=Xenopus tropicalis GN=mcm8 PE=2 SV=1 358 936 1.0E-88
sp|Q9CWV1|MCM8_MOUSE DNA helicase MCM8 OS=Mus musculus GN=Mcm8 PE=1 SV=3 358 987 6.0E-88
sp|A4FUD9|MCM3_BOVIN DNA replication licensing factor MCM3 OS=Bos taurus GN=MCM3 PE=2 SV=1 366 898 2.0E-86
sp|Q5R8G6|MCM3_PONAB DNA replication licensing factor MCM3 OS=Pongo abelii GN=MCM3 PE=2 SV=1 366 898 8.0E-85
sp|P25206|MCM3_MOUSE DNA replication licensing factor MCM3 OS=Mus musculus GN=Mcm3 PE=1 SV=2 366 898 9.0E-85
sp|Q9XYU0|MCM7_DROME DNA replication licensing factor Mcm7 OS=Drosophila melanogaster GN=Mcm7 PE=1 SV=1 364 898 1.0E-84
sp|Q61J08|MCM6_CAEBR DNA replication licensing factor mcm-6 OS=Caenorhabditis briggsae GN=mcm-6 PE=3 SV=1 363 899 2.0E-84
sp|P25205|MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens GN=MCM3 PE=1 SV=3 366 898 3.0E-84
sp|Q9UJA3|MCM8_HUMAN DNA helicase MCM8 OS=Homo sapiens GN=MCM8 PE=1 SV=2 358 924 8.0E-84
sp|Q9XYU1|MCM3_DROME DNA replication licensing factor Mcm3 OS=Drosophila melanogaster GN=Mcm3 PE=1 SV=1 375 898 3.0E-83
sp|I0IUP3|MCM8_CHICK DNA helicase MCM8 OS=Gallus gallus GN=MCM8 PE=1 SV=1 358 924 4.0E-83
sp|Q7ZXZ0|MCM3Z_XENLA Zygotic DNA replication licensing factor mcm3 OS=Xenopus laevis GN=zmcm3 PE=1 SV=1 366 898 7.0E-83
sp|P34647|MCM6_CAEEL DNA replication licensing factor mcm-6 OS=Caenorhabditis elegans GN=mcm-6 PE=1 SV=1 363 899 2.0E-82
sp|Q28BS0|MCM3Z_XENTR Zygotic DNA replication licensing factor mcm3 OS=Xenopus tropicalis GN=zmcm3 PE=2 SV=1 366 898 5.0E-82
sp|Q5ZMN2|MCM3_CHICK DNA replication licensing factor MCM3 OS=Gallus gallus GN=MCM3 PE=2 SV=1 366 898 9.0E-81
sp|Q62724|MCM6_RAT DNA replication licensing factor MCM6 (Fragment) OS=Rattus norvegicus GN=Mcm6 PE=1 SV=2 564 899 3.0E-80
sp|Q24849|MCM3_ENTHI DNA replication licensing factor MCM3 OS=Entamoeba histolytica GN=MCM3 PE=3 SV=1 375 907 1.0E-78
sp|B8AZ14|MCM8_ORYSI Probable DNA helicase MCM8 OS=Oryza sativa subsp. indica GN=MCM8 PE=3 SV=1 363 931 3.0E-78
sp|Q9SF37|MCM8_ARATH Probable DNA helicase MCM8 OS=Arabidopsis thaliana GN=MCM8 PE=2 SV=2 351 939 4.0E-78
sp|E1BPX4|MCM8_BOVIN DNA helicase MCM8 OS=Bos taurus GN=MCM8 PE=3 SV=2 358 924 1.0E-77
sp|B9FKM7|MCM8_ORYSJ Probable DNA helicase MCM8 OS=Oryza sativa subsp. japonica GN=MCM8 PE=2 SV=1 363 931 2.0E-77
sp|P24279|MCM3_YEAST DNA replication licensing factor MCM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM3 PE=1 SV=1 375 790 2.0E-74
sp|F4IFF3|MCM9_ARATH Probable DNA helicase MCM9 OS=Arabidopsis thaliana GN=MCM9 PE=3 SV=1 385 903 2.0E-71
sp|Q69QA6|MCM9_ORYSJ Probable DNA helicase MCM9 OS=Oryza sativa subsp. japonica GN=MCM9 PE=2 SV=1 258 903 9.0E-70
sp|Q2KHI9|MCM9_MOUSE DNA helicase MCM9 OS=Mus musculus GN=Mcm9 PE=1 SV=2 381 903 2.0E-69
sp|F1M5F3|MCM9_RAT DNA helicase MCM9 OS=Rattus norvegicus GN=Mcm9 PE=3 SV=2 381 903 8.0E-69
sp|B8B406|MCM9_ORYSI Probable DNA helicase MCM9 OS=Oryza sativa subsp. indica GN=MCM9 PE=3 SV=1 258 903 2.0E-68
sp|Q9NXL9|MCM9_HUMAN DNA helicase MCM9 OS=Homo sapiens GN=MCM9 PE=1 SV=4 381 903 1.0E-67
sp|Q6NRM6|MCM9_XENLA DNA helicase MCM9 OS=Xenopus laevis GN=mcm9 PE=1 SV=1 381 903 4.0E-67
sp|F1N2W9|MCM9_BOVIN DNA helicase MCM9 OS=Bos taurus GN=MCM9 PE=3 SV=2 381 903 1.0E-66
sp|F6RIX4|MCM9_XENTR DNA helicase MCM9 OS=Xenopus tropicalis GN=mcm9 PE=3 SV=1 381 903 3.0E-66
sp|F1QDI9|MCM9_DANRE DNA helicase MCM9 OS=Danio rerio GN=mcm9 PE=3 SV=2 363 882 2.0E-65
sp|I0IUP4|MCM9_CHICK DNA helicase MCM9 OS=Gallus gallus GN=MCM9 PE=1 SV=2 338 903 3.0E-63
sp|Q58884|Y1489_METJA Uncharacterized MCM-type protein MJ1489 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1489 PE=3 SV=1 370 934 2.0E-55
sp|Q58371|Y961_METJA Uncharacterized MCM-type protein MJ0961 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0961 PE=3 SV=1 572 938 1.0E-43
sp|Q57809|Y363_METJA Uncharacterized MCM-type protein MJ0363 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0363 PE=3 SV=1 372 912 1.0E-40
sp|Q9VF30|MCMR_DROME DNA replication licensing factor REC OS=Drosophila melanogaster GN=rec PE=1 SV=2 290 792 1.0E-29
sp|Q60275|Y3513_METJA Uncharacterized MCM-type protein MJECL13 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJECL13 PE=3 SV=1 481 915 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0032508 DNA duplex unwinding Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0032392 DNA geometric change No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0006996 organelle organization No
GO:0003676 nucleic acid binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0008150 biological_process No
GO:0071103 DNA conformation change No
GO:0051276 chromosome organization No
GO:0017076 purine nucleotide binding No
GO:0016043 cellular component organization No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0009987 cellular process No
GO:0071840 cellular component organization or biogenesis No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2251
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4599 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2104
Ophiocordyceps camponoti-floridani Ophcf2|00324
Ophiocordyceps camponoti-rufipedis Ophun1|3306
Ophiocordyceps kimflemingae Ophio5|1339
Ophiocordyceps subramaniannii Hirsu2|2916

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4599
MSSPSNRRLRSSQSATPRRQPSQLASSPLMFQSSPVAGQDRGDVSSPLRQESDTQSTNGPRVAPSSPLRQMSNSQ
SQNDDGQRTPRASGALTGESSPIRYDPSSSPGRSNRLQSELRSESSGIFVGSQRSTALRRGDIHSDAVNTPQPLQ
RRRVIVGPDGRVLSDAPGSDAGSFSQRHVNTSDADALGGKSETQIWGTTVSIDDTFVSFKGFLRNFTQKYRRWRD
GESLQDAAADADAESKPYMEALENMLLLGTTRLYLDLADLNAYPPTRKLWHQIQAYPQEIVPIMDQSISDVMEEL
AEAEKARSRPHMTDASKTQSSDPVFPNSDLADGDGSGAATPRPRQEPSKSTRDDDDVMPYYIVRPFGLPKTINLR
DLNPSDMDRLICIKGLVIRTTPVIPDMKSAFFRCNVCNHSVNVALDRGKIQEPTECPRPVCESKNSMQIVHNRCV
FEDKQVIKLQETPDAVPAGQTPHSVSVCVYNELVDYCKAGDRVELTGIFRVSPVRVNPRLRAIKSIFKTYVDVLH
VQKSDKKRMGIDVSTALGMDEDEEQAEHGRERLEETRVVTPEDEARIRETAARPDIYDVLARSLAPSIFQMDDVK
KGILLQLFGGTNKNFAKGGSPKYRGDINVLLCGDPSTSKSQLLSYVHKIAPRGIYTSGKGSSAVGLTAYVTRDPE
TRQLVLESGALVLSDGGVCCIDEFDKMSDATRSVLHEVMEQQTVSVAKAGIITTLNARSSILASANPIGSRYNPD
LSVPQNIDLPPTLLSRFDLVYLILDRFDPDSDKALAKHLLSLFVQDCPDSAPSARDILPVEFLTLYISYARANIH
PSISPAAAAKLVDCYVAMRALGADVHAAEKRITATTRQLESMIRLAEAHARMRLSDSVLPADVDEAYRLIQAALK
TAATDAHGRIDMSLLVDGSSAADRQRRADLRDAVLRALDDATAGGNSVRWADVARRVAEAAATDVDMAEFGEVMR
VLQGENAILVTGEGARRSVRRVTAVV*
Coding >OphauG2|4599
ATGTCGTCGCCGTCGAACCGGCGCCTGCGCAGCTCCCAGTCGGCAACGCCGCGCCGGCAGCCGTCGCAGCTCGCG
TCAAGCCCCCTCATGTTCCAATCCTCACCAGTAGCAGGACAGGACAGGGGGGATGTGTCGTCGCCGCTGCGGCAG
GAGTCGGATACGCAGAGTACCAATGGGCCGCGGGTTGCGCCCAGCTCGCCGTTACGGCAGATGAGCAATTCGCAG
AGCCAGAATGACGACGGGCAGCGGACGCCGAGGGCAAGCGGTGCTCTGACGGGAGAATCCTCGCCCATTCGCTAC
GACCCCAGCTCCAGCCCCGGCCGGTCCAACAGGCTGCAGTCGGAGCTTCGCAGCGAAAGCAGCGGCATCTTTGTC
GGCTCGCAGCGCTCCACTGCCCTGCGGCGCGGCGACATCCACTCGGATGCTGTAAACACTCCGCAGCCCCTGCAG
CGTCGCCGCGTCATTGTTGGCCCCGACGGGCGCGTCCTCAGCGACGCTCCCGGGTCCGACGCGGGCTCGTTTTCG
CAGCGCCATGTAAACACGTCGGATGCCGATGCCTTGGGCGGCAAGAGTGAGACGCAGATTTGGGGAACGACGGTG
TCGATTGACGACACGTTTGTTTCCTTCAAGGGCTTCTTGCGCAACTTTACGCAAAAGTATCGCAGGTGGCGCGAC
GGCGAGTCGCTGCAGGACGCTGCAGCCGATGCAGACGCCGAGTCGAAGCCCTACATGGAGGCGCTGGAGAACATG
CTGCTGCTGGGCACCACGAGGCTCTACCTGGACCTGGCCGATCTCAATGCGTACCCGCCCACGCGCAAGCTGTGG
CATCAGATTCAGGCTTATCCTCAGGAAATCGTTCCAATCATGGACCAGTCGATTAGCGATGTCATGGAGGAGCTC
GCCGAGGCCGAAAAGGCGCGCTCTCGTCCTCACATGACGGACGCGTCCAAGACGCAAAGCTCGGATCCCGTCTTT
CCCAACTCGGATCTGGCTGACGGCGACGGCTCGGGCGCTGCGACTCCGCGGCCGCGTCAGGAGCCGAGCAAGTCG
ACGCGCGACGACGACGACGTCATGCCTTATTACATTGTGCGGCCGTTTGGTCTGCCCAAGACGATTAATCTGCGA
GACCTGAACCCGTCTGACATGGATCGGTTAATCTGCATCAAGGGGCTCGTGATCCGCACGACTCCCGTCATCCCC
GACATGAAGAGCGCCTTTTTCCGCTGCAACGTGTGCAACCACTCGGTCAACGTGGCCCTGGACCGCGGCAAGATC
CAGGAGCCGACCGAGTGCCCGCGCCCCGTGTGCGAGTCCAAGAACTCGATGCAAATCGTGCACAACCGCTGCGTC
TTTGAGGACAAGCAAGTCATCAAGCTGCAGGAGACGCCCGACGCAGTGCCGGCCGGCCAGACGCCGCACTCGGTG
TCTGTGTGCGTGTACAATGAGCTGGTTGACTACTGCAAGGCGGGCGACCGAGTAGAGCTGACGGGCATTTTCCGG
GTGAGCCCGGTGCGCGTGAATCCGCGGCTGCGCGCCATCAAGAGCATCTTCAAGACATATGTCGACGTGCTGCAT
GTGCAAAAGTCGGACAAGAAGCGCATGGGCATCGACGTGTCGACGGCGCTGGGCATGGACGAGGACGAGGAGCAG
GCCGAGCACGGGCGGGAGCGCCTGGAGGAGACGCGCGTGGTGACGCCAGAAGACGAGGCCAGGATTCGCGAGACG
GCGGCGCGGCCCGACATTTACGACGTGCTGGCGCGGTCGCTGGCCCCGTCCATCTTCCAAATGGACGATGTCAAA
AAGGGCATCCTGCTGCAGCTGTTTGGCGGCACCAACAAGAACTTTGCCAAAGGCGGCAGCCCCAAGTACCGCGGC
GACATCAACGTGCTGCTCTGCGGCGACCCGTCCACGTCCAAGTCGCAGCTGCTGTCGTACGTGCACAAGATTGCG
CCGCGCGGCATCTACACCAGCGGCAAGGGCTCGTCGGCCGTGGGCCTCACCGCCTATGTCACGCGCGACCCGGAA
ACGCGCCAGCTGGTGCTCGAATCCGGCGCCCTGGTGCTCTCGGACGGCGGCGTGTGCTGCATCGACGAGTTTGAC
AAGATGTCTGACGCGACGCGCTCCGTCCTGCACGAGGTGATGGAGCAGCAGACCGTGTCCGTGGCCAAGGCTGGC
ATCATCACCACGCTCAATGCCCGCAGCAGCATCCTCGCCTCGGCAAACCCCATTGGCAGCCGCTACAACCCCGAC
TTGTCCGTCCCGCAAAACATTGACCTGCCGCCCACCCTGCTCTCCCGCTTCGACCTGGTCTACCTCATCCTCGAC
CGCTTCGACCCCGACTCGGACAAGGCGCTCGCCAAGCACCTCCTCTCGCTCTTTGTCCAGGACTGCCCCGACTCC
GCCCCCTCGGCCCGCGACATCCTCCCCGTCGAGTTCCTCACCCTCTACATCTCGTATGCCCGCGCAAACATCCAC
CCCTCCATCTCGCCCGCCGCTGCCGCCAAGCTCGTCGACTGCTACGTCGCCATGCGCGCCCTCGGCGCCGACGTG
CACGCCGCCGAGAAACGCATCACCGCCACCACGCGCCAGCTCGAAAGCATGATTCGTCTCGCCGAGGCCCACGCC
CGCATGCGCCTCAGCGACTCTGTCCTCCCCGCCGACGTGGACGAGGCCTACCGCCTCATCCAAGCCGCCCTCAAA
ACTGCCGCCACCGACGCCCACGGCCGCATCGACATGAGCCTCCTCGTCGACGGCTCCTCCGCTGCCGATCGCCAG
CGCCGCGCGGACCTTCGCGATGCCGTCCTCCGAGCCTTGGATGACGCGACCGCTGGCGGCAACTCGGTCCGCTGG
GCCGACGTGGCGCGGCGCGTCGCCGAGGCTGCTGCCACAGATGTGGACATGGCAGAGTTTGGAGAAGTCATGCGG
GTCCTGCAGGGCGAGAATGCAATCTTGGTCACGGGCGAGGGGGCTAGGCGTAGTGTGAGGCGCGTCACGGCCGTG
GTTTAG
Transcript >OphauG2|4599
ATGTCGTCGCCGTCGAACCGGCGCCTGCGCAGCTCCCAGTCGGCAACGCCGCGCCGGCAGCCGTCGCAGCTCGCG
TCAAGCCCCCTCATGTTCCAATCCTCACCAGTAGCAGGACAGGACAGGGGGGATGTGTCGTCGCCGCTGCGGCAG
GAGTCGGATACGCAGAGTACCAATGGGCCGCGGGTTGCGCCCAGCTCGCCGTTACGGCAGATGAGCAATTCGCAG
AGCCAGAATGACGACGGGCAGCGGACGCCGAGGGCAAGCGGTGCTCTGACGGGAGAATCCTCGCCCATTCGCTAC
GACCCCAGCTCCAGCCCCGGCCGGTCCAACAGGCTGCAGTCGGAGCTTCGCAGCGAAAGCAGCGGCATCTTTGTC
GGCTCGCAGCGCTCCACTGCCCTGCGGCGCGGCGACATCCACTCGGATGCTGTAAACACTCCGCAGCCCCTGCAG
CGTCGCCGCGTCATTGTTGGCCCCGACGGGCGCGTCCTCAGCGACGCTCCCGGGTCCGACGCGGGCTCGTTTTCG
CAGCGCCATGTAAACACGTCGGATGCCGATGCCTTGGGCGGCAAGAGTGAGACGCAGATTTGGGGAACGACGGTG
TCGATTGACGACACGTTTGTTTCCTTCAAGGGCTTCTTGCGCAACTTTACGCAAAAGTATCGCAGGTGGCGCGAC
GGCGAGTCGCTGCAGGACGCTGCAGCCGATGCAGACGCCGAGTCGAAGCCCTACATGGAGGCGCTGGAGAACATG
CTGCTGCTGGGCACCACGAGGCTCTACCTGGACCTGGCCGATCTCAATGCGTACCCGCCCACGCGCAAGCTGTGG
CATCAGATTCAGGCTTATCCTCAGGAAATCGTTCCAATCATGGACCAGTCGATTAGCGATGTCATGGAGGAGCTC
GCCGAGGCCGAAAAGGCGCGCTCTCGTCCTCACATGACGGACGCGTCCAAGACGCAAAGCTCGGATCCCGTCTTT
CCCAACTCGGATCTGGCTGACGGCGACGGCTCGGGCGCTGCGACTCCGCGGCCGCGTCAGGAGCCGAGCAAGTCG
ACGCGCGACGACGACGACGTCATGCCTTATTACATTGTGCGGCCGTTTGGTCTGCCCAAGACGATTAATCTGCGA
GACCTGAACCCGTCTGACATGGATCGGTTAATCTGCATCAAGGGGCTCGTGATCCGCACGACTCCCGTCATCCCC
GACATGAAGAGCGCCTTTTTCCGCTGCAACGTGTGCAACCACTCGGTCAACGTGGCCCTGGACCGCGGCAAGATC
CAGGAGCCGACCGAGTGCCCGCGCCCCGTGTGCGAGTCCAAGAACTCGATGCAAATCGTGCACAACCGCTGCGTC
TTTGAGGACAAGCAAGTCATCAAGCTGCAGGAGACGCCCGACGCAGTGCCGGCCGGCCAGACGCCGCACTCGGTG
TCTGTGTGCGTGTACAATGAGCTGGTTGACTACTGCAAGGCGGGCGACCGAGTAGAGCTGACGGGCATTTTCCGG
GTGAGCCCGGTGCGCGTGAATCCGCGGCTGCGCGCCATCAAGAGCATCTTCAAGACATATGTCGACGTGCTGCAT
GTGCAAAAGTCGGACAAGAAGCGCATGGGCATCGACGTGTCGACGGCGCTGGGCATGGACGAGGACGAGGAGCAG
GCCGAGCACGGGCGGGAGCGCCTGGAGGAGACGCGCGTGGTGACGCCAGAAGACGAGGCCAGGATTCGCGAGACG
GCGGCGCGGCCCGACATTTACGACGTGCTGGCGCGGTCGCTGGCCCCGTCCATCTTCCAAATGGACGATGTCAAA
AAGGGCATCCTGCTGCAGCTGTTTGGCGGCACCAACAAGAACTTTGCCAAAGGCGGCAGCCCCAAGTACCGCGGC
GACATCAACGTGCTGCTCTGCGGCGACCCGTCCACGTCCAAGTCGCAGCTGCTGTCGTACGTGCACAAGATTGCG
CCGCGCGGCATCTACACCAGCGGCAAGGGCTCGTCGGCCGTGGGCCTCACCGCCTATGTCACGCGCGACCCGGAA
ACGCGCCAGCTGGTGCTCGAATCCGGCGCCCTGGTGCTCTCGGACGGCGGCGTGTGCTGCATCGACGAGTTTGAC
AAGATGTCTGACGCGACGCGCTCCGTCCTGCACGAGGTGATGGAGCAGCAGACCGTGTCCGTGGCCAAGGCTGGC
ATCATCACCACGCTCAATGCCCGCAGCAGCATCCTCGCCTCGGCAAACCCCATTGGCAGCCGCTACAACCCCGAC
TTGTCCGTCCCGCAAAACATTGACCTGCCGCCCACCCTGCTCTCCCGCTTCGACCTGGTCTACCTCATCCTCGAC
CGCTTCGACCCCGACTCGGACAAGGCGCTCGCCAAGCACCTCCTCTCGCTCTTTGTCCAGGACTGCCCCGACTCC
GCCCCCTCGGCCCGCGACATCCTCCCCGTCGAGTTCCTCACCCTCTACATCTCGTATGCCCGCGCAAACATCCAC
CCCTCCATCTCGCCCGCCGCTGCCGCCAAGCTCGTCGACTGCTACGTCGCCATGCGCGCCCTCGGCGCCGACGTG
CACGCCGCCGAGAAACGCATCACCGCCACCACGCGCCAGCTCGAAAGCATGATTCGTCTCGCCGAGGCCCACGCC
CGCATGCGCCTCAGCGACTCTGTCCTCCCCGCCGACGTGGACGAGGCCTACCGCCTCATCCAAGCCGCCCTCAAA
ACTGCCGCCACCGACGCCCACGGCCGCATCGACATGAGCCTCCTCGTCGACGGCTCCTCCGCTGCCGATCGCCAG
CGCCGCGCGGACCTTCGCGATGCCGTCCTCCGAGCCTTGGATGACGCGACCGCTGGCGGCAACTCGGTCCGCTGG
GCCGACGTGGCGCGGCGCGTCGCCGAGGCTGCTGCCACAGATGTGGACATGGCAGAGTTTGGAGAAGTCATGCGG
GTCCTGCAGGGCGAGAATGCAATCTTGGTCACGGGCGAGGGGGCTAGGCGTAGTGTGAGGCGCGTCACGGCCGTG
GTTTAG
Gene >OphauG2|4599
ATGTCGTCGCCGTCGAACCGGCGCCTGCGCAGCTCCCAGTCGGCAACGCCGCGCCGGCAGCCGTCGCAGCTCGCG
TCAAGCCCCCTCATGTTCCAATCCTCACCAGTAGCAGGACAGGACAGGGGGGATGTGTCGTCGCCGCTGCGGCAG
GAGTCGGATACGCAGAGTACCAATGGGCCGCGGGTTGCGCCCAGCTCGCCGTTACGGCAGATGAGCAATTCGCAG
AGCCAGAATGACGACGGGCAGCGGACGCCGAGGGCAAGCGGTGCTCTGACGGGAGGTGAATGCCCTTTGTCTTTG
TGTCGCTATTGCCATGGCCATTTCTCTTTTGCCTTTTTTCTCTGTCCTCTTTCAACCAAAAGTCTTTTTTGGAGC
TGGCTTTTTGCATCTCTAACACGTTGCAGAATCCTCGCCCATTCGCTACGACCCCAGCTCCAGCCCCGGCCGGTC
CAACAGGCTGCAGTCGGAGCTTCGCAGCGAAAGCAGCGGCATCTTTGTCGGCTCGCAGCGCTCCACTGCCCTGCG
GCGCGGCGACATCCACTCGGATGCTGTAAACACTCCGCAGCCCCTGCAGCGTCGCCGCGTCATTGTTGGCCCCGA
CGGGCGCGTCCTCAGCGACGCTCCCGGGTCCGACGCGGGCTCGTTTTCGCAGCGCCATGTAAACACGTCGGATGC
CGATGCCTTGGGCGGCAAGAGTGAGACGCAGATTTGGGGAACGACGGTGTCGATTGACGACACGTTTGTTTCCTT
CAAGGGCTTCTTGCGCAACTTTACGCAAAAGTATCGCAGGTGGCGCGACGGCGAGTCGCTGCAGGACGCTGCAGC
CGATGCAGACGCCGAGTCGAAGCCCTACATGGAGGCGCTGGAGAACATGCTGCTGCTGGGCACCACGAGGCTCTA
CCTGGACCTGGCCGATCTCAATGCGTACCCGCCCACGCGCAAGCTGTGGCATCAGATTCAGGCTTATCCTCAGGA
AATCGTTCCAATCATGGACCAGTCGATTAGCGATGTCATGGAGGAGCTCGCCGAGGCCGAAAAGGCGCGCTCTCG
TCCTCACATGACGGACGCGTCCAAGACGCAAAGCTCGGATCCCGTCTTTCCCAACTCGGATCTGGCTGACGGCGA
CGGCTCGGGCGCTGCGACTCCGCGGCCGCGTCAGGAGCCGAGCAAGTCGACGCGCGACGACGACGACGTCATGCC
TTATTACATTGTGCGGCCGTTTGGTCTGCCCAAGACGATTAATCTGCGAGACCTGAACCCGTCTGGTGAGAATGC
CACTGACGCTCACATGCCATGACGGCCTTGCTGACCTGGCCGTGATGGCAGACATGGATCGGTTAATCTGCATCA
AGGGGCTCGTGATCCGCACGACTCCCGTCATCCCCGACATGAAGAGCGCCTTTTTCCGCTGCAACGTGTGCAACC
ACTCGGTCAACGTGGCCCTGGACCGCGGCAAGATCCAGGAGCCGACCGAGTGCCCGCGCCCCGTGTGCGAGTCCA
AGAACTCGATGCAAATCGTGCACAACCGCTGCGTCTTTGAGGACAAGCAAGTCATCAAGCTGCAGGAGACGCCCG
ACGCAGTGCCGGCCGGCCAGACGCCGCACTCGGTGTCTGTGTGCGTGTACAATGAGCTGGTTGACTACTGCAAGG
CGGGCGACCGAGTAGAGCTGACGGGCATTTTCCGGGTGAGCCCGGTGCGCGTGAATCCGCGGCTGCGCGCCATCA
AGAGCATCTTCAAGACATATGTCGACGTGCTGCATGTGCAAAAGTCGGACAAGAAGCGCATGGGCATCGACGTGT
CGACGGCGCTGGGCATGGACGAGGACGAGGAGCAGGCCGAGCACGGGCGGGAGCGCCTGGAGGAGACGCGCGTGG
TGACGCCAGAAGACGAGGCCAGGATTCGCGAGACGGCGGCGCGGCCCGACATTTACGACGTGCTGGCGCGGTCGC
TGGCCCCGTCCATCTTCCAAATGGACGATGTCAAAAAGGGCATCCTGCTGCAGCTGTTTGGCGGCACCAACAAGA
ACTTTGCCAAAGGCGGCAGCCCCAAGTACCGCGGCGACATCAACGTGCTGCTCTGCGGCGACCCGTCCACGTCCA
AGTCGCAGCTGCTGTCGTACGTGCACAAGATTGCGCCGCGCGGCATCTACACCAGCGGCAAGGGCTCGTCGGCCG
TGGGCCTCACCGCCTATGTCACGCGCGACCCGGAAACGCGCCAGCTGGTGCTCGAATCCGGCGCCCTGGTGCTCT
CGGACGGCGGCGTGTGCTGCATCGACGAGTTTGACAAGATGTCTGACGCGACGCGCTCCGTCCTGCACGAGGTGA
TGGAGCAGCAGACCGTGTCCGTGGCCAAGGCTGGCATCATCACCACGCTCAATGCCCGCAGCAGCATCCTCGCCT
CGGCAAACCCCATTGGCAGCCGCTACAACCCCGACTTGTCCGTCCCGCAAAACATTGACCTGCCGCCCACCCTGC
TCTCCCGCTTCGACCTGGTCTACCTCATCCTCGACCGCTTCGACCCCGACTCGGACAAGGCGCTCGCCAAGCACC
TCCTCTCGCTCTTTGTCCAGGACTGCCCCGACTCCGCCCCCTCGGCCCGCGACATCCTCCCCGTCGAGTTCCTCA
CCCTCTACATCTCGTATGCCCGCGCAAACATCCACCCCTCCATCTCGCCCGCCGCTGCCGCCAAGCTCGTCGACT
GCTACGTCGCCATGCGCGCCCTCGGCGCCGACGTGCACGCCGCCGAGAAACGCATCACCGCCACCACGCGCCAGC
TCGAAAGCATGATTCGTCTCGCCGAGGCCCACGCCCGCATGCGCCTCAGCGACTCTGTCCTCCCCGCCGACGTGG
ACGAGGCCTACCGCCTCATCCAAGCCGCCCTCAAAACTGCCGCCACCGACGCCCACGGCCGCATCGACATGAGCC
TCCTCGTCGACGGCTCCTCCGCTGCCGATCGCCAGCGCCGCGCGGACCTTCGCGATGCCGTCCTCCGAGCCTTGG
ATGACGCGACCGCTGGCGGCAACTCGGTCCGCTGGGCCGACGTGGCGCGGCGCGTCGCCGAGGCTGCTGCCACAG
ATGTGGACATGGCAGAGTTTGGAGAAGTCATGCGGGTCCTGCAGGGCGAGAATGCAATCTTGGTCACGGGCGAGG
GGGCTAGGCGTAGTGTGAGGCGCGTCACGGCCGTGGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail