Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4596
Gene name
LocationContig_390:11149..12497
Strand+
Gene length (bp)1348
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13622 4HBT_3 Thioesterase-like superfamily 2.5E-26 88 393

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P0AGG2|TESB_ECOLI Acyl-CoA thioesterase 2 OS=Escherichia coli (strain K12) GN=tesB PE=1 SV=2 96 393 1.0E-06
sp|P0AGG3|TESB_ECO57 Acyl-CoA thioesterase 2 OS=Escherichia coli O157:H7 GN=tesB PE=3 SV=2 96 393 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3729
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4596 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|8121
Ophiocordyceps camponoti-floridani Ophcf2|01688
Ophiocordyceps camponoti-rufipedis Ophun1|4683
Ophiocordyceps kimflemingae Ophio5|4677
Ophiocordyceps subramaniannii Hirsu2|728

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4596
MTDSKVYSEQHRAVVEAWIQKQYDGSYAGSGRTWPRLSFQDALALTEISAGADLQGRSVKRFVSRRPAWKPGGEL
PWDLLFKDLKGPKPMHQGPGVFGGVVYAQAPLAAARAIEAEDIAETGADTDKKPRGKLGIHSIQGVFTSPGLRDR
PFIFEVSPLSTGKSFATRLVNVRQPTQPSEPPTGPFSASDADKPLKNVCFSCMTTFKRSAPTPDDVQTAQSPQQR
YADILSKREPHEWPMSPQSDVDLIRDLFPHEGPGAFPVLNMHKVDMTEYNESLPVPERRELIYYRLLEPLPGDDV
NAHIVCHAFEADRNGLIMLGNHIGYGYGLGRAASLSYSFYVHVNPEEAVMGDQGWWLQEVSWPRVSAGRCMMECR
IWSPQGRHVASAYQDGMILPSEASKL*
Coding >OphauG2|4596
ATGACCGACTCAAAGGTTTACAGCGAACAGCATCGCGCCGTCGTCGAAGCATGGATACAGAAGCAGTACGACGGT
AGCTACGCCGGCTCAGGCCGCACCTGGCCGCGATTGAGTTTCCAAGACGCACTAGCCCTCACAGAAATATCTGCC
GGCGCAGATTTGCAAGGCCGGTCAGTCAAGCGCTTCGTCAGCCGCCGCCCAGCCTGGAAGCCCGGCGGCGAGCTG
CCGTGGGACCTGCTGTTCAAGGACCTCAAAGGCCCGAAACCCATGCACCAGGGCCCTGGTGTTTTCGGTGGCGTC
GTCTATGCTCAGGCTCCTCTTGCCGCTGCACGAGCCATCGAGGCCGAGGACATAGCCGAAACCGGTGCTGATACA
GACAAGAAGCCTAGAGGCAAGCTGGGCATACATTCGATTCAAGGCGTCTTTACAAGCCCTGGCCTTCGCGACCGG
CCCTTCATCTTCGAGGTGTCTCCCCTGTCGACCGGCAAGTCGTTTGCAACGCGCCTTGTCAATGTTCGCCAGCCC
ACGCAGCCCTCGGAGCCGCCAACGGGACCCTTCTCCGCCTCAGACGCCGACAAGCCACTCAAGAATGTCTGCTTC
AGCTGCATGACAACATTCAAGCGCTCCGCGCCAACTCCAGACGATGTCCAGACGGCCCAATCGCCCCAGCAGCGC
TACGCCGACATCCTGTCCAAACGCGAGCCTCACGAATGGCCCATGAGCCCTCAGTCGGACGTGGACTTGATTCGA
GACCTGTTCCCCCACGAGGGGCCAGGCGCGTTCCCCGTGCTCAACATGCACAAGGTGGACATGACGGAGTACAAC
GAGAGTCTGCCGGTGCCCGAGCGGCGCGAGCTGATATACTACCGGCTGCTGGAGCCGCTACCTGGCGACGATGTC
AACGCACACATTGTGTGCCACGCCTTTGAAGCCGATCGCAACGGGCTCATCATGCTCGGCAATCACATTGGATAC
GGCTACGGCCTGGGGCGTGCGGCAAGCCTGAGCTACTCGTTTTACGTGCACGTCAATCCGGAAGAGGCAGTCATG
GGCGATCAAGGCTGGTGGCTACAGGAGGTGTCGTGGCCACGAGTGAGCGCTGGCAGATGCATGATGGAGTGTCGT
ATCTGGAGCCCTCAGGGACGTCATGTTGCCAGTGCCTACCAGGATGGCATGATTTTGCCGTCCGAGGCGTCGAAG
CTGTAG
Transcript >OphauG2|4596
ATGACCGACTCAAAGGTTTACAGCGAACAGCATCGCGCCGTCGTCGAAGCATGGATACAGAAGCAGTACGACGGT
AGCTACGCCGGCTCAGGCCGCACCTGGCCGCGATTGAGTTTCCAAGACGCACTAGCCCTCACAGAAATATCTGCC
GGCGCAGATTTGCAAGGCCGGTCAGTCAAGCGCTTCGTCAGCCGCCGCCCAGCCTGGAAGCCCGGCGGCGAGCTG
CCGTGGGACCTGCTGTTCAAGGACCTCAAAGGCCCGAAACCCATGCACCAGGGCCCTGGTGTTTTCGGTGGCGTC
GTCTATGCTCAGGCTCCTCTTGCCGCTGCACGAGCCATCGAGGCCGAGGACATAGCCGAAACCGGTGCTGATACA
GACAAGAAGCCTAGAGGCAAGCTGGGCATACATTCGATTCAAGGCGTCTTTACAAGCCCTGGCCTTCGCGACCGG
CCCTTCATCTTCGAGGTGTCTCCCCTGTCGACCGGCAAGTCGTTTGCAACGCGCCTTGTCAATGTTCGCCAGCCC
ACGCAGCCCTCGGAGCCGCCAACGGGACCCTTCTCCGCCTCAGACGCCGACAAGCCACTCAAGAATGTCTGCTTC
AGCTGCATGACAACATTCAAGCGCTCCGCGCCAACTCCAGACGATGTCCAGACGGCCCAATCGCCCCAGCAGCGC
TACGCCGACATCCTGTCCAAACGCGAGCCTCACGAATGGCCCATGAGCCCTCAGTCGGACGTGGACTTGATTCGA
GACCTGTTCCCCCACGAGGGGCCAGGCGCGTTCCCCGTGCTCAACATGCACAAGGTGGACATGACGGAGTACAAC
GAGAGTCTGCCGGTGCCCGAGCGGCGCGAGCTGATATACTACCGGCTGCTGGAGCCGCTACCTGGCGACGATGTC
AACGCACACATTGTGTGCCACGCCTTTGAAGCCGATCGCAACGGGCTCATCATGCTCGGCAATCACATTGGATAC
GGCTACGGCCTGGGGCGTGCGGCAAGCCTGAGCTACTCGTTTTACGTGCACGTCAATCCGGAAGAGGCAGTCATG
GGCGATCAAGGCTGGTGGCTACAGGAGGTGTCGTGGCCACGAGTGAGCGCTGGCAGATGCATGATGGAGTGTCGT
ATCTGGAGCCCTCAGGGACGTCATGTTGCCAGTGCCTACCAGGATGGCATGATTTTGCCGTCCGAGGCGTCGAAG
CTGTAG
Gene >OphauG2|4596
ATGACCGACTCAAAGGTTTACAGCGAACAGCATCGCGCCGTCGTCGAAGCATGGTCTGGCTTTTCAACCCCCCCC
TTTTCTGCATCCCTCGTCTTGTCCCATGCTTACCGTCAATGCAGGATACAGAAGCAGTACGACGGTAGCTACGCC
GGCTCAGGCCGCACCTGGCCGCGATTGAGTTTCCAAGACGCACTAGCCCTCACAGAAATATCTGCCGGCGCAGAT
TTGCAAGGCCGGTCAGTCAAGCGCTTCGTCAGCCGCCGCCCAGCCTGGAAGCCCGGCGGCGAGCTGCCGTGGGAC
CTGCTGTTCAAGGACCTCAAAGGCCCGAAACCCATGCACCAGGGCCCTGGTGTTTTCGGTGGCGTCGTCTATGCT
CAGGCTCCTCTTGCCGCTGCACGAGCCATCGAGGCCGAGGACATAGCCGAAACCGGTGCTGATACAGACAAGAAG
CCTAGAGGCAAGCTGGGCATACATGTGAGTGCCGCTGTCGCTGTCGCTTTCCCAGCCGGCCTTGGCTCACCCTTT
GGCTAACCCTTTGGCCATGCGGTAGTCGATTCAAGGCGTCTTTACAAGCCCTGGCCTTCGCGACCGGCCCTTCAT
CTTCGAGGTGTCTCCCCTGTCGACCGGCAAGTCGTTTGCAACGCGCCTTGTCAATGTTCGCCAGCCCACGCAGCC
CTCGGAGCCGCCAACGGGACCCTTCTCCGCCTCAGACGCCGACAAGCCACTCAAGAATGTCTGCTTCAGCTGCAT
GACAACATTCAAGCGCTCCGCGCCAACTCCAGACGATGTCCAGACGGCCCAATCGCCCCAGCAGCGCTACGCCGA
CATCCTGTCCAAACGCGAGCCTCACGAATGGCCCATGAGCCCTCAGTCGGACGTGGACTTGATTCGAGACCTGTT
CCCCCACGAGGGGCCAGGCGCGTTCCCCGTGCTCAACATGCACAAGGTGGACATGACGGAGTACAACGAGAGTCT
GCCGGTGCCCGAGCGGCGCGAGCTGATATACTACCGGCTGCTGGAGCCGCTACCTGGCGACGATGTCAACGCACA
CATTGTGTGCCACGCCTTTGAAGCCGATCGCAACGGGCTCATCATGCTCGGCAATCACATTGGATACGGCTACGG
CCTGGGGCGTGCGGCAAGCCTGAGCTACTCGTTTTACGTGCACGTCAATCCGGAAGAGGCAGTCATGGGCGATCA
AGGCTGGTGGCTACAGGAGGTGTCGTGGCCACGAGTGAGCGCTGGCAGATGCATGATGGAGTGTCGTATCTGGAG
CCCTCAGGGACGTCATGTTGCCAGTGCCTACCAGGATGGCATGATTTTGCCGTCCGAGGCGTCGAAGCTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail