Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4591
Gene name
LocationContig_390:335..1862
Strand-
Gene length (bp)1527
Transcript length (bp)1461
Coding sequence length (bp)1461
Protein length (aa) 487

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 2.1E-07 296 331
PF00400 WD40 WD domain, G-beta repeat 1.7E-03 388 426
PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex 3.8E-11 90 155
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 2.5E-04 300 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P783|RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrb1 PE=1 SV=1 1 485 4.0E-135
sp|Q04225|RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRB1 PE=1 SV=1 28 486 1.0E-125
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 35 483 5.0E-97
sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 60 486 4.0E-94
sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 74 486 3.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P783|RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrb1 PE=1 SV=1 1 485 4.0E-135
sp|Q04225|RRB1_YEAST Ribosome assembly protein RRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRB1 PE=1 SV=1 28 486 1.0E-125
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 35 483 5.0E-97
sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 60 486 4.0E-94
sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 74 486 3.0E-93
sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 74 486 1.0E-92
sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=1 SV=2 74 486 3.0E-92
sp|Q6INH0|RBP4B_XENLA Histone-binding protein RBBP4-B OS=Xenopus laevis GN=rbbp4-b PE=1 SV=3 184 477 8.0E-34
sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 184 477 8.0E-34
sp|Q9W7I5|RBBP4_CHICK Histone-binding protein RBBP4 OS=Gallus gallus GN=RBBP4 PE=1 SV=3 184 477 1.0E-33
sp|Q5RF92|RBBP4_PONAB Histone-binding protein RBBP4 OS=Pongo abelii GN=RBBP4 PE=2 SV=3 184 477 1.0E-33
sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus GN=Rbbp4 PE=1 SV=5 184 477 1.0E-33
sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens GN=RBBP4 PE=1 SV=3 184 477 1.0E-33
sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos taurus GN=RBBP4 PE=1 SV=3 184 477 1.0E-33
sp|O93377|RBP4A_XENLA Histone-binding protein RBBP4-A OS=Xenopus laevis GN=rbbp4-a PE=1 SV=3 209 477 2.0E-33
sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 91 477 5.0E-33
sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 184 477 1.0E-32
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 184 477 2.0E-32
sp|Q8AVH1|RBBP7_XENLA Histone-binding protein RBBP7 OS=Xenopus laevis GN=rbbp7 PE=2 SV=1 91 477 2.0E-32
sp|Q6P315|RBBP7_XENTR Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1 91 477 4.0E-32
sp|Q60973|RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus GN=Rbbp7 PE=1 SV=1 91 477 9.0E-32
sp|Q71UF4|RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus GN=Rbbp7 PE=2 SV=1 91 477 9.0E-32
sp|Q4R304|RBBP7_MACFA Histone-binding protein RBBP7 OS=Macaca fascicularis GN=RBBP7 PE=2 SV=1 91 477 9.0E-32
sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens GN=RBBP7 PE=1 SV=1 91 477 9.0E-32
sp|Q9I8G9|RBBP7_CHICK Histone-binding protein RBBP7 OS=Gallus gallus GN=RBBP7 PE=1 SV=1 91 477 9.0E-32
sp|Q3SWX8|RBBP7_BOVIN Histone-binding protein RBBP7 OS=Bos taurus GN=RBBP7 PE=2 SV=1 91 477 2.0E-31
sp|Q5R654|RBBP7_PONAB Histone-binding protein RBBP7 OS=Pongo abelii GN=RBBP7 PE=3 SV=1 91 477 7.0E-30
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 184 477 4.0E-29
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 91 477 5.0E-29
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 210 481 6.0E-29
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 96 477 1.0E-28
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 96 477 6.0E-28
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 210 477 9.0E-28
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 210 477 9.0E-28
sp|O94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 96 471 3.0E-27
sp|O22467|MSI1_ARATH Histone-binding protein MSI1 OS=Arabidopsis thaliana GN=MSI1 PE=1 SV=1 96 465 4.0E-27
sp|O22466|MSI1_SOLLC WD-40 repeat-containing protein MSI1 OS=Solanum lycopersicum GN=MSI1 PE=2 SV=1 96 465 2.0E-26
sp|Q54SD4|RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 96 477 2.0E-26
sp|Q10G81|MSI1_ORYSJ Histone-binding protein MSI1 homolog OS=Oryza sativa subsp. japonica GN=MSI1 PE=2 SV=1 96 465 4.0E-26
sp|Q6C7Q4|HAT2_YARLI Histone acetyltransferase type B subunit 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAT2 PE=3 SV=1 225 477 9.0E-26
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 210 486 7.0E-25
sp|P90917|RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1 144 486 7.0E-24
sp|Q7S7N3|HAT2_NEUCR Histone acetyltransferase type B subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hat-2 PE=3 SV=2 210 453 1.0E-23
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 184 480 9.0E-21
sp|Q75C99|HAT2_ASHGO Histone acetyltransferase type B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT2 PE=3 SV=1 162 482 6.0E-19
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 194 482 2.0E-18
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 96 477 2.0E-18
sp|O22469|MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana GN=MSI3 PE=1 SV=2 174 480 1.0E-17
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 240 428 2.0E-17
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 247 428 4.0E-17
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 240 428 7.0E-17
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 240 428 8.0E-17
sp|Q6FXI8|HAT2_CANGA Histone acetyltransferase type B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAT2 PE=3 SV=1 194 482 8.0E-17
sp|P39984|HAT2_YEAST Histone acetyltransferase type B subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAT2 PE=1 SV=1 166 483 1.0E-16
sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 244 430 5.0E-16
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 247 428 6.0E-16
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 249 424 5.0E-15
sp|B3MC74|CIAO1_DROAN Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila ananassae GN=Ciao1 PE=3 SV=1 249 424 7.0E-15
sp|Q7K1Y4|CIAO1_DROME Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila melanogaster GN=Ciao1 PE=1 SV=1 249 424 1.0E-14
sp|B4GDM7|CIAO1_DROPE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila persimilis GN=Ciao1 PE=3 SV=2 249 424 1.0E-14
sp|Q292E8|CIAO1_DROPS Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila pseudoobscura pseudoobscura GN=Ciao1 PE=3 SV=1 249 424 1.0E-14
sp|B4QFZ8|CIAO1_DROSI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila simulans GN=Ciao1 PE=3 SV=1 249 424 1.0E-14
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 247 428 2.0E-14
sp|B4HRQ6|CIAO1_DROSE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila sechellia GN=Ciao1 PE=3 SV=1 249 424 2.0E-14
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 249 424 4.0E-14
sp|Q6BK34|HAT2_DEBHA Histone acetyltransferase type B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAT2 PE=3 SV=1 243 465 5.0E-14
sp|B4MY77|CIAO1_DROWI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila willistoni GN=Ciao1 PE=3 SV=1 249 424 9.0E-14
sp|O22607|MSI4_ARATH WD-40 repeat-containing protein MSI4 OS=Arabidopsis thaliana GN=MSI4 PE=1 SV=3 178 477 3.0E-13
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 249 424 8.0E-13
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 249 424 1.0E-12
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 239 428 2.0E-12
sp|Q9SU78|MSI5_ARATH WD-40 repeat-containing protein MSI5 OS=Arabidopsis thaliana GN=MSI5 PE=1 SV=2 298 476 2.0E-12
sp|A4RD35|SEC31_MAGO7 Protein transport protein SEC31 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SEC31 PE=3 SV=1 270 485 2.0E-12
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 245 432 3.0E-12
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 223 427 3.0E-12
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 296 443 7.0E-12
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 249 424 1.0E-11
sp|Q2GVT8|SEC31_CHAGB Protein transport protein SEC31 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC31 PE=3 SV=1 301 481 2.0E-11
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 268 427 4.0E-11
sp|P0CS47|PFS2_CRYNB Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFS2 PE=3 SV=1 268 486 5.0E-11
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 247 436 5.0E-11
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 301 481 6.0E-11
sp|P0CS46|PFS2_CRYNJ Polyadenylation factor subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFS2 PE=3 SV=1 268 486 7.0E-11
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 234 427 8.0E-11
sp|Q59RH5|HAT2_CANAL Histone acetyltransferase type B subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAT2 PE=3 SV=1 253 465 8.0E-11
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 234 427 1.0E-10
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 250 424 1.0E-10
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 234 427 1.0E-10
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 248 436 2.0E-10
sp|Q12834|CDC20_HUMAN Cell division cycle protein 20 homolog OS=Homo sapiens GN=CDC20 PE=1 SV=2 247 438 3.0E-10
sp|Q5ZLG9|WDR59_CHICK WD repeat-containing protein 59 OS=Gallus gallus GN=WDR59 PE=2 SV=1 259 426 3.0E-10
sp|Q5H7C0|CDC20_PIG Cell division cycle protein 20 homolog OS=Sus scrofa GN=CDC20 PE=2 SV=1 247 438 3.0E-10
sp|Q68FJ6|PK1IP_XENLA p21-activated protein kinase-interacting protein 1-like OS=Xenopus laevis GN=pak1ip1 PE=2 SV=1 270 480 3.0E-10
sp|Q6PJI9|WDR59_HUMAN WD repeat-containing protein 59 OS=Homo sapiens GN=WDR59 PE=1 SV=2 259 426 4.0E-10
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 255 436 4.0E-10
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 247 439 6.0E-10
sp|Q5FVP5|WDR89_RAT WD repeat-containing protein 89 OS=Rattus norvegicus GN=Wdr89 PE=2 SV=1 296 462 6.0E-10
sp|Q9NQW1|SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens GN=SEC31B PE=1 SV=1 274 427 7.0E-10
sp|Q8C0M0|WDR59_MOUSE WD repeat-containing protein 59 OS=Mus musculus GN=Wdr59 PE=1 SV=2 259 426 9.0E-10
sp|Q8L611|SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana GN=SEC31B PE=1 SV=1 303 474 1.0E-09
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 248 436 1.0E-09
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 258 408 1.0E-09
sp|O14021|PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prw1 PE=1 SV=1 300 482 1.0E-09
sp|Q62623|CDC20_RAT Cell division cycle protein 20 homolog OS=Rattus norvegicus GN=Cdc20 PE=1 SV=2 247 438 1.0E-09
sp|P13712|MSI1_YEAST Chromatin assembly factor 1 subunit p50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSI1 PE=1 SV=1 304 430 2.0E-09
sp|Q5AAU3|SEC31_CANAL Protein transport protein SEC31 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC31 PE=3 SV=1 301 481 2.0E-09
sp|Q0CYG9|SEC31_ASPTN Protein transport protein sec31 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec31 PE=3 SV=1 270 466 3.0E-09
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 250 439 3.0E-09
sp|Q3TZ89|SC31B_MOUSE Protein transport protein Sec31B OS=Mus musculus GN=Sec31b PE=1 SV=2 216 428 4.0E-09
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 206 427 4.0E-09
sp|Q39190|PRL2_ARATH Protein pleiotropic regulator PRL2 OS=Arabidopsis thaliana GN=PRL2 PE=2 SV=2 294 431 5.0E-09
sp|Q40507|GBB3_TOBAC Guanine nucleotide-binding protein subunit beta OS=Nicotiana tabacum PE=2 SV=1 295 431 7.0E-09
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 294 431 8.0E-09
sp|Q55CT5|SEC31_DICDI Protein transport protein SEC31 OS=Dictyostelium discoideum GN=sec31 PE=3 SV=1 262 481 8.0E-09
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 296 427 1.0E-08
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 212 427 1.0E-08
sp|Q5R4F4|SC31A_PONAB Protein transport protein Sec31A OS=Pongo abelii GN=SEC31A PE=2 SV=1 210 427 1.0E-08
sp|P93397|GBB1_TOBAC Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1 295 431 1.0E-08
sp|P93339|GBB_NICPL Guanine nucleotide-binding protein subunit beta OS=Nicotiana plumbaginifolia PE=2 SV=1 295 431 1.0E-08
sp|P61480|WDR12_RAT Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 298 426 2.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 258 482 2.0E-08
sp|O94979|SC31A_HUMAN Protein transport protein Sec31A OS=Homo sapiens GN=SEC31A PE=1 SV=3 248 427 2.0E-08
sp|A5DB75|SEC31_PICGU Protein transport protein SEC31 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SEC31 PE=3 SV=2 300 477 2.0E-08
sp|Q9JJA4|WDR12_MOUSE Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 298 426 2.0E-08
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 245 416 2.0E-08
sp|P93398|GBB2_TOBAC Guanine nucleotide-binding protein subunit beta-2 OS=Nicotiana tabacum PE=2 SV=1 295 431 2.0E-08
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 247 439 2.0E-08
sp|Q5AZM3|SEC31_EMENI Protein transport protein sec31 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sec31 PE=3 SV=2 270 466 2.0E-08
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 301 477 3.0E-08
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 284 480 3.0E-08
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 428 3.0E-08
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 296 467 3.0E-08
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 298 426 4.0E-08
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 298 426 4.0E-08
sp|Q920M5|CORO6_MOUSE Coronin-6 OS=Mus musculus GN=Coro6 PE=1 SV=1 281 426 4.0E-08
sp|Q9Z2Q1|SC31A_RAT Protein transport protein Sec31A OS=Rattus norvegicus GN=Sec31a PE=1 SV=2 210 427 4.0E-08
sp|Q920J3|CORO6_RAT Coronin-6 OS=Rattus norvegicus GN=Coro6 PE=2 SV=2 300 426 4.0E-08
sp|Q5F3X8|SC31A_CHICK Protein transport protein Sec31A OS=Gallus gallus GN=SEC31A PE=2 SV=1 251 427 4.0E-08
sp|Q3UPL0|SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus GN=Sec31a PE=1 SV=2 210 427 4.0E-08
sp|A2QBZ0|SEC31_ASPNC Protein transport protein sec31 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec31 PE=3 SV=1 270 485 5.0E-08
sp|O62621|COPB2_DROME Coatomer subunit beta' OS=Drosophila melanogaster GN=beta'COP PE=2 SV=2 296 425 5.0E-08
sp|P93563|GBB_SOLTU Guanine nucleotide-binding protein subunit beta OS=Solanum tuberosum GN=GB1 PE=2 SV=1 295 431 5.0E-08
sp|Q6BRR2|SEC31_DEBHA Protein transport protein SEC31 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC31 PE=3 SV=2 271 426 6.0E-08
sp|O14021|PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prw1 PE=1 SV=1 295 425 7.0E-08
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 301 425 8.0E-08
sp|Q2UF60|SEC31_ASPOR Protein transport protein sec31 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sec31 PE=3 SV=2 301 485 8.0E-08
sp|Q96P53|WDFY2_HUMAN WD repeat and FYVE domain-containing protein 2 OS=Homo sapiens GN=WDFY2 PE=1 SV=2 271 377 8.0E-08
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 298 465 9.0E-08
sp|O80990|CIA1_ARATH Protein CIA1 OS=Arabidopsis thaliana GN=CIA1 PE=1 SV=2 291 425 1.0E-07
sp|O13637|SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec31 PE=1 SV=1 317 477 1.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 296 427 1.0E-07
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 247 427 1.0E-07
sp|Q9C0J8|WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 247 430 1.0E-07
sp|Q8BUB4|WDFY2_MOUSE WD repeat and FYVE domain-containing protein 2 OS=Mus musculus GN=Wdfy2 PE=1 SV=2 298 377 1.0E-07
sp|A1C6X5|SEC31_ASPCL Protein transport protein sec31 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec31 PE=3 SV=1 270 477 1.0E-07
sp|Q9UQ03|COR2B_HUMAN Coronin-2B OS=Homo sapiens GN=CORO2B PE=1 SV=4 281 422 1.0E-07
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 290 425 1.0E-07
sp|Q8BH44|COR2B_MOUSE Coronin-2B OS=Mus musculus GN=Coro2b PE=1 SV=2 281 422 1.0E-07
sp|C4R6H3|LIS1_PICPG Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 287 426 1.0E-07
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 298 426 1.0E-07
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 247 439 1.0E-07
sp|Q8K4P0|WDR33_MOUSE pre-mRNA 3' end processing protein WDR33 OS=Mus musculus GN=Wdr33 PE=1 SV=1 247 430 1.0E-07
sp|A1DHK2|SEC31_NEOFI Protein transport protein sec31 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sec31 PE=3 SV=1 270 477 1.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 247 427 2.0E-07
sp|Q8BX17|GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus GN=Gemin5 PE=1 SV=2 236 485 2.0E-07
sp|P49177|GBB_ARATH Guanine nucleotide-binding protein subunit beta OS=Arabidopsis thaliana GN=GB1 PE=1 SV=1 295 431 2.0E-07
sp|Q32LP9|COR2A_BOVIN Coronin-2A OS=Bos taurus GN=CORO2A PE=2 SV=1 300 426 2.0E-07
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 300 427 2.0E-07
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 248 427 2.0E-07
sp|P38968|SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC31 PE=1 SV=3 271 426 2.0E-07
sp|Q6GPP0|WDR70_XENLA WD repeat-containing protein 70 OS=Xenopus laevis GN=wdr70 PE=2 SV=2 233 427 2.0E-07
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 296 427 2.0E-07
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 296 427 2.0E-07
sp|A8WGE3|COR2B_XENTR Coronin-2B OS=Xenopus tropicalis GN=coro2b PE=2 SV=1 281 426 2.0E-07
sp|Q6QEF8|CORO6_HUMAN Coronin-6 OS=Homo sapiens GN=CORO6 PE=1 SV=2 300 426 2.0E-07
sp|Q5XIL8|DNAI1_RAT Dynein intermediate chain 1, axonemal OS=Rattus norvegicus GN=Dnai1 PE=1 SV=1 271 414 2.0E-07
sp|Q0VA16|WDR70_XENTR WD repeat-containing protein 70 OS=Xenopus tropicalis GN=wdr70 PE=2 SV=1 233 427 2.0E-07
sp|Q6DJD8|COR2B_XENLA Coronin-2B OS=Xenopus laevis GN=coro2b PE=2 SV=1 300 426 2.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 247 485 3.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 427 3.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 244 428 3.0E-07
sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 296 427 3.0E-07
sp|Q20168|COPB2_CAEEL Probable coatomer subunit beta' OS=Caenorhabditis elegans GN=copb-2 PE=3 SV=3 298 425 3.0E-07
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 229 427 3.0E-07
sp|A3GFK8|SEC31_PICST Protein transport protein SEC31 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=SEC31 PE=3 SV=2 301 481 4.0E-07
sp|Q4P2B6|SEC31_USTMA Protein transport protein SEC31 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SEC31 PE=3 SV=1 301 427 4.0E-07
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 298 427 4.0E-07
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 247 475 4.0E-07
sp|Q08E38|PRP19_BOVIN Pre-mRNA-processing factor 19 OS=Bos taurus GN=PRPF19 PE=2 SV=1 259 427 4.0E-07
sp|Q13216|ERCC8_HUMAN DNA excision repair protein ERCC-8 OS=Homo sapiens GN=ERCC8 PE=1 SV=1 244 443 4.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 248 427 4.0E-07
sp|Q8C0M8|DNAI1_MOUSE Dynein intermediate chain 1, axonemal OS=Mus musculus GN=Dnai1 PE=1 SV=1 271 414 4.0E-07
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 298 442 4.0E-07
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 298 466 5.0E-07
sp|O24467|LE14B_PRUAR LEC14B homolog OS=Prunus armeniaca PE=2 SV=1 318 427 5.0E-07
sp|Q75A30|SEC31_ASHGO Protein transport protein SEC31 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC31 PE=3 SV=2 305 426 5.0E-07
sp|Q9D0R9|WDR89_MOUSE WD repeat-containing protein 89 OS=Mus musculus GN=Wdr89 PE=2 SV=1 269 462 5.0E-07
sp|Q4X0M4|SEC31_ASPFU Protein transport protein sec31 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sec31 PE=3 SV=1 270 477 5.0E-07
sp|P14197|AAC3_DICDI WD repeat-containing protein AAC3 OS=Dictyostelium discoideum GN=AAC3 PE=2 SV=2 292 419 5.0E-07
sp|Q5RBZ3|WDR89_PONAB WD repeat-containing protein 89 OS=Pongo abelii GN=WDR89 PE=2 SV=1 296 435 6.0E-07
sp|Q9JMJ4|PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus GN=Prpf19 PE=1 SV=2 259 427 6.0E-07
sp|Q99KP6|PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus GN=Prpf19 PE=1 SV=1 259 427 6.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 268 427 6.0E-07
sp|Q8C0P5|COR2A_MOUSE Coronin-2A OS=Mus musculus GN=Coro2a PE=2 SV=1 300 426 6.0E-07
sp|A5DTX3|SEC31_LODEL Protein transport protein SEC31 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SEC31 PE=3 SV=1 210 477 6.0E-07
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 298 427 6.0E-07
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 300 465 7.0E-07
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 291 475 7.0E-07
sp|Q5EB92|WDR70_RAT WD repeat-containing protein 70 OS=Rattus norvegicus GN=Wdr70 PE=1 SV=1 275 427 7.0E-07
sp|Q5BJ90|WDR12_XENTR Ribosome biogenesis protein wdr12 OS=Xenopus tropicalis GN=wdr12 PE=2 SV=1 298 426 7.0E-07
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 296 427 7.0E-07
sp|Q6CKE8|PRP46_KLULA Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP46 PE=3 SV=1 295 427 7.0E-07
sp|Q6TNS2|PK1IP_DANRE p21-activated protein kinase-interacting protein 1-like OS=Danio rerio GN=pak1ip1 PE=2 SV=1 299 427 7.0E-07
sp|Q29RH4|THOC3_BOVIN THO complex subunit 3 OS=Bos taurus GN=THOC3 PE=2 SV=1 252 424 7.0E-07
sp|Q3TWF6|WDR70_MOUSE WD repeat-containing protein 70 OS=Mus musculus GN=Wdr70 PE=1 SV=1 275 427 7.0E-07
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 292 430 7.0E-07
sp|Q5ZMC3|WSDU1_CHICK WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 297 395 7.0E-07
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 245 380 8.0E-07
sp|Q9VKK2|WDR59_DROME WD repeat-containing protein 59 homolog OS=Drosophila melanogaster GN=CG4705 PE=1 SV=3 298 428 8.0E-07
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 248 427 8.0E-07
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 248 427 8.0E-07
sp|Q8VE80|THOC3_MOUSE THO complex subunit 3 OS=Mus musculus GN=Thoc3 PE=2 SV=1 252 424 8.0E-07
sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 252 424 9.0E-07
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 245 425 9.0E-07
sp|P31146|COR1A_HUMAN Coronin-1A OS=Homo sapiens GN=CORO1A PE=1 SV=4 271 424 9.0E-07
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 229 482 9.0E-07
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 207 427 9.0E-07
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 298 466 9.0E-07
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 249 447 1.0E-06
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 296 456 1.0E-06
sp|Q9UI46|DNAI1_HUMAN Dynein intermediate chain 1, axonemal OS=Homo sapiens GN=DNAI1 PE=1 SV=1 271 407 1.0E-06
sp|Q9UMS4|PRP19_HUMAN Pre-mRNA-processing factor 19 OS=Homo sapiens GN=PRPF19 PE=1 SV=1 259 427 1.0E-06
sp|C5DJV1|RTC1_LACTC Restriction of telomere capping protein 1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=RTC1 PE=3 SV=1 301 428 1.0E-06
sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 296 466 1.0E-06
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 301 425 1.0E-06
sp|O17468|HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 232 430 1.0E-06
sp|Q32LB0|WDR70_BOVIN WD repeat-containing protein 70 OS=Bos taurus GN=WDR70 PE=2 SV=1 275 427 1.0E-06
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 291 427 1.0E-06
sp|Q40153|LE14B_LITER LEC14B protein OS=Lithospermum erythrorhizon PE=2 SV=1 300 427 1.0E-06
sp|Q9DCE5|PK1IP_MOUSE p21-activated protein kinase-interacting protein 1 OS=Mus musculus GN=Pak1ip1 PE=1 SV=2 299 482 1.0E-06
sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens GN=GEMIN5 PE=1 SV=3 210 401 1.0E-06
sp|Q03897|WDR59_YEAST Maintenance of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTC5 PE=1 SV=1 298 428 1.0E-06
sp|Q9WUC8|PLRG1_RAT Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1 296 427 1.0E-06
sp|Q2KID6|PLRG1_BOVIN Pleiotropic regulator 1 OS=Bos taurus GN=PLRG1 PE=2 SV=1 296 427 1.0E-06
sp|Q9NWT1|PK1IP_HUMAN p21-activated protein kinase-interacting protein 1 OS=Homo sapiens GN=PAK1IP1 PE=1 SV=2 299 428 1.0E-06
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 249 447 2.0E-06
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 296 466 2.0E-06
sp|Q9SU78|MSI5_ARATH WD-40 repeat-containing protein MSI5 OS=Arabidopsis thaliana GN=MSI5 PE=1 SV=2 251 339 2.0E-06
sp|Q9NQW1|SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens GN=SEC31B PE=1 SV=1 216 427 2.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 268 428 2.0E-06
sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens GN=GEMIN5 PE=1 SV=3 236 485 2.0E-06
sp|O43660|PLRG1_HUMAN Pleiotropic regulator 1 OS=Homo sapiens GN=PLRG1 PE=1 SV=1 296 427 2.0E-06
sp|Q32KS2|DNAI1_BOVIN Dynein intermediate chain 1, axonemal OS=Bos taurus GN=DNAI1 PE=2 SV=1 271 431 2.0E-06
sp|O89046|COR1B_RAT Coronin-1B OS=Rattus norvegicus GN=Coro1b PE=1 SV=1 278 426 2.0E-06
sp|Q92176|COR1A_BOVIN Coronin-1A OS=Bos taurus GN=CORO1A PE=1 SV=3 271 424 2.0E-06
sp|Q922V4|PLRG1_MOUSE Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=1 SV=1 296 427 2.0E-06
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 266 475 2.0E-06
sp|O35142|COPB2_RAT Coatomer subunit beta' OS=Rattus norvegicus GN=Copb2 PE=1 SV=3 295 425 2.0E-06
sp|Q54MZ3|CDC20_DICDI Anaphase-promoting complex subunit cdc20 OS=Dictyostelium discoideum GN=cdc20 PE=1 SV=1 296 426 2.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 234 427 2.0E-06
sp|Q04491|SEC13_YEAST Protein transport protein SEC13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC13 PE=1 SV=1 239 425 2.0E-06
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 247 428 2.0E-06
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 296 445 2.0E-06
sp|F4ICD9|SC31A_ARATH Protein transport protein SEC31 homolog A OS=Arabidopsis thaliana GN=SEC31A PE=1 SV=1 290 474 2.0E-06
sp|F4K5R6|CDC26_ARATH Cell division cycle 20.6, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-6 PE=3 SV=1 247 427 2.0E-06
sp|Q4R4I8|COPB2_MACFA Coatomer subunit beta' OS=Macaca fascicularis GN=COPB2 PE=2 SV=1 295 425 2.0E-06
sp|O55029|COPB2_MOUSE Coatomer subunit beta' OS=Mus musculus GN=Copb2 PE=1 SV=2 295 425 2.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 296 445 2.0E-06
sp|P35605|COPB2_BOVIN Coatomer subunit beta' OS=Bos taurus GN=COPB2 PE=1 SV=3 295 425 2.0E-06
sp|Q5R664|COPB2_PONAB Coatomer subunit beta' OS=Pongo abelii GN=COPB2 PE=2 SV=1 295 425 2.0E-06
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 296 445 2.0E-06
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 249 430 2.0E-06
sp|P35606|COPB2_HUMAN Coatomer subunit beta' OS=Homo sapiens GN=COPB2 PE=1 SV=2 295 425 2.0E-06
sp|Q9FKT5|THOC3_ARATH THO complex subunit 3 OS=Arabidopsis thaliana GN=THO3 PE=1 SV=1 251 418 2.0E-06
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 301 427 3.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 298 445 3.0E-06
sp|P90794|DCA11_CAEEL DDB1- and CUL4-associated factor 11 homolog OS=Caenorhabditis elegans GN=wdr-23 PE=3 SV=1 313 427 3.0E-06
sp|Q0ULF5|SEC31_PHANO Protein transport protein SEC31 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SEC31 PE=3 SV=3 301 407 3.0E-06
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 263 426 3.0E-06
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 301 426 3.0E-06
sp|Q54DS4|Y2056_DICDI WD repeat-containing protein DDB_G0292056 OS=Dictyostelium discoideum GN=DDB_G0292056 PE=3 SV=1 298 426 3.0E-06
sp|P47025|MDV1_YEAST Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDV1 PE=1 SV=1 298 431 3.0E-06
sp|Q9NW82|WDR70_HUMAN WD repeat-containing protein 70 OS=Homo sapiens GN=WDR70 PE=1 SV=1 275 427 3.0E-06
sp|Q3E906|CD205_ARATH Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana GN=CDC20-5 PE=1 SV=2 247 427 3.0E-06
sp|Q9WUM3|COR1B_MOUSE Coronin-1B OS=Mus musculus GN=Coro1b PE=1 SV=1 278 426 3.0E-06
sp|B3RNR8|CIAO1_TRIAD Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 245 477 3.0E-06
sp|A6ZQL5|MDV1_YEAS7 Mitochondrial division protein 1 OS=Saccharomyces cerevisiae (strain YJM789) GN=MDV1 PE=3 SV=1 298 431 3.0E-06
sp|Q96FK6|WDR89_HUMAN WD repeat-containing protein 89 OS=Homo sapiens GN=WDR89 PE=2 SV=1 296 435 3.0E-06
sp|Q5EA99|PK1IP_BOVIN p21-activated protein kinase-interacting protein 1 OS=Bos taurus GN=PAK1IP1 PE=2 SV=1 299 428 3.0E-06
sp|Q6CSZ5|SEC13_KLULA Protein transport protein SEC13 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC13 PE=3 SV=1 239 425 3.0E-06
sp|P93397|GBB1_TOBAC Guanine nucleotide-binding protein subunit beta-1 OS=Nicotiana tabacum PE=1 SV=1 295 454 4.0E-06
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 207 396 4.0E-06
sp|Q75A30|SEC31_ASHGO Protein transport protein SEC31 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC31 PE=3 SV=2 260 427 4.0E-06
sp|A8XEN7|DCA11_CAEBR DDB1- and CUL4-associated factor 11 homolog OS=Caenorhabditis briggsae GN=wdr-23 PE=3 SV=2 313 427 4.0E-06
sp|Q9XS70|COR1B_RABIT Coronin-1B OS=Oryctolagus cuniculus GN=CORO1B PE=1 SV=1 300 426 4.0E-06
sp|A2QHM1|SEC13_ASPNC Protein transport protein sec13 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sec13 PE=3 SV=1 239 425 4.0E-06
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 253 442 4.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 248 427 4.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 248 427 4.0E-06
sp|Q9W1J3|GAD1_DROME Gastrulation defective protein 1 homolog OS=Drosophila melanogaster GN=CG5543 PE=2 SV=1 267 427 4.0E-06
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 264 426 4.0E-06
sp|Q2KJJ5|TBL3_BOVIN Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1 298 443 4.0E-06
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 250 447 5.0E-06
sp|Q9UTN4|PFS2_SCHPO Polyadenylation factor subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfs2 PE=3 SV=1 229 427 5.0E-06
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 207 396 5.0E-06
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 264 426 5.0E-06
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 247 425 5.0E-06
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 270 425 5.0E-06
sp|Q9ULV4|COR1C_HUMAN Coronin-1C OS=Homo sapiens GN=CORO1C PE=1 SV=1 281 426 5.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 245 428 5.0E-06
sp|Q17BB0|WDR12_AEDAE Ribosome biogenesis protein WDR12 homolog OS=Aedes aegypti GN=AAEL005041 PE=3 SV=1 300 429 5.0E-06
sp|Q6FJZ9|PRP46_CANGA Pre-mRNA-splicing factor PRP46 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP46 PE=3 SV=1 295 431 5.0E-06
sp|Q92828|COR2A_HUMAN Coronin-2A OS=Homo sapiens GN=CORO2A PE=2 SV=2 300 426 5.0E-06
sp|C5MIB1|RTC1_CANTT Restriction of telomere capping protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=RTC1 PE=3 SV=1 269 413 6.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 270 425 6.0E-06
sp|Q55AR8|SNR40_DICDI U5 small nuclear ribonucleoprotein 40 kDa protein OS=Dictyostelium discoideum GN=snrnp40 PE=3 SV=1 236 432 6.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 270 425 6.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 238 428 6.0E-06
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 253 442 7.0E-06
sp|Q10051|PRP19_CAEEL Pre-mRNA-processing factor 19 OS=Caenorhabditis elegans GN=prp-19 PE=3 SV=2 296 427 7.0E-06
sp|Q55DA2|CIAO1_DICDI Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Dictyostelium discoideum GN=ciao1 PE=3 SV=1 258 425 7.0E-06
sp|Q96S15|WDR24_HUMAN WD repeat-containing protein 24 OS=Homo sapiens GN=WDR24 PE=1 SV=1 295 427 7.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 270 425 7.0E-06
sp|B3RNR8|CIAO1_TRIAD Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_20668 PE=3 SV=1 285 434 8.0E-06
sp|Q3ZBK1|WDR89_BOVIN WD repeat-containing protein 89 OS=Bos taurus GN=WDR89 PE=2 SV=1 296 434 8.0E-06
sp|Q5S580|SEC31_AJECA Protein transport protein SEC31 OS=Ajellomyces capsulatus GN=SEC31 PE=1 SV=1 270 485 8.0E-06
sp|Q5NVK4|COR1B_PONAB Coronin-1B OS=Pongo abelii GN=CORO1B PE=2 SV=2 300 426 8.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 270 425 9.0E-06
sp|Q54JS5|WDR24_DICDI WD repeat-containing protein 24 homolog OS=Dictyostelium discoideum GN=wdr24 PE=3 SV=1 253 427 1.0E-05
sp|Q8L828|COB23_ARATH Coatomer subunit beta'-3 OS=Arabidopsis thaliana GN=At3g15980 PE=2 SV=1 289 425 1.0E-05
sp|Q9BR76|COR1B_HUMAN Coronin-1B OS=Homo sapiens GN=CORO1B PE=1 SV=1 300 426 1.0E-05
sp|Q5E9I8|DCA11_BOVIN DDB1- and CUL4-associated factor 11 OS=Bos taurus GN=DCAF11 PE=2 SV=1 321 427 1.0E-05
sp|Q9WUM4|COR1C_MOUSE Coronin-1C OS=Mus musculus GN=Coro1c PE=1 SV=2 281 426 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4591
MSKRTVDVSNGHGPLKGGDRPEPMDIDDKEMGDFEDDFEDEFESEDEIFEAGVDGRPDAEREAEEKAATGVEQKT
FIVGRTKLEPGQTLAPDLSTYKMLHNLSTPWPCLSFDIVGDSLGDNRKAYPATMYTVAGTQADYSKTNENQLLVS
KLSGLSRMEHDGDEESDDDDDDEDGDPILESKSIPLNSTTNRIRAHQIPSSEAGRPPTTLTATMTESGSVFIHDV
TPHLASFDQPGMAVTAQQNKPISTIRAHKAEGYALDWSPTVAGSKLLTGDNDGIIYMTIRTDGGGWVTDSRPFQG
HTGSVEEIQWSPSEQFVFASASSDGTVRIWDVRSKARKAAITVQASNSDVNVMSWSRQTTHLLASGADDGVWGVW
DLRQWKAGADKPQPLASFDFHKEQITSLEWHPTDDSIMAVAAGDSTVTLWDLAVELDDEESRETAGVKDVPPQLL
FVHYLKDVKEVHWHPQIPGSLMATGEEFSVFRTISV*
Coding >OphauG2|4591
ATGTCGAAGCGCACAGTCGACGTCAGTAACGGGCATGGCCCTCTCAAGGGTGGCGACCGGCCCGAACCCATGGAC
ATTGACGACAAAGAAATGGGCGACTTTGAAGACGACTTTGAAGACGAGTTTGAGAGCGAAGACGAGATTTTCGAG
GCGGGAGTAGATGGGCGACCAGACGCCGAGCGAGAAGCTGAGGAAAAAGCCGCCACGGGCGTGGAGCAGAAAACT
TTTATAGTCGGGCGCACAAAACTCGAGCCGGGACAGACGCTGGCGCCGGACCTCTCGACATACAAGATGCTACAC
AACCTCAGCACTCCTTGGCCCTGTCTTTCATTTGACATTGTGGGCGACTCGCTGGGAGACAATCGCAAGGCCTAC
CCGGCCACCATGTACACGGTTGCCGGAACCCAGGCAGACTACTCCAAGACCAATGAGAATCAGCTCCTGGTCAGC
AAGCTGAGCGGGCTGAGCAGAATGGAACATGACGGAGACGAGGAATCAGATGACGACGACGACGACGAAGATGGC
GATCCGATTCTGGAGAGCAAGTCCATACCGCTCAACTCGACAACCAACCGCATACGCGCCCATCAGATTCCCAGC
TCGGAAGCAGGGAGACCGCCGACTACTCTCACAGCCACCATGACGGAATCAGGCAGCGTCTTTATCCATGACGTG
ACGCCGCATTTGGCGTCGTTTGACCAGCCGGGAATGGCAGTCACGGCGCAGCAGAACAAGCCCATCTCGACGATA
CGGGCGCACAAGGCAGAAGGATATGCTCTTGACTGGTCTCCTACGGTGGCTGGCAGCAAGCTGCTGACGGGCGAC
AACGACGGTATAATTTATATGACGATTCGAACCGACGGGGGAGGCTGGGTGACGGACTCGAGGCCTTTCCAAGGC
CACACGGGCAGCGTGGAGGAAATCCAGTGGTCGCCATCGGAGCAATTTGTCTTTGCATCGGCATCGAGCGACGGC
ACAGTACGCATCTGGGATGTGCGGTCCAAGGCGCGCAAGGCGGCCATTACAGTGCAGGCATCCAACAGCGACGTC
AATGTCATGTCGTGGTCGCGGCAAACGACACACCTGCTTGCATCCGGGGCGGATGACGGCGTCTGGGGCGTGTGG
GACTTGAGGCAGTGGAAGGCTGGGGCGGACAAGCCACAGCCGCTGGCGAGCTTCGACTTTCACAAGGAGCAGATT
ACGAGTCTAGAGTGGCATCCGACGGACGATTCCATCATGGCGGTGGCGGCAGGAGATAGCACGGTGACGCTCTGG
GACCTGGCAGTGGAGCTGGACGACGAGGAGAGCCGAGAGACGGCCGGGGTCAAGGATGTGCCGCCGCAGCTGCTC
TTTGTGCACTACCTCAAGGACGTCAAGGAGGTGCACTGGCACCCGCAAATACCGGGCAGTCTGATGGCGACGGGC
GAGGAATTCAGCGTCTTTAGGACGATAAGCGTGTGA
Transcript >OphauG2|4591
ATGTCGAAGCGCACAGTCGACGTCAGTAACGGGCATGGCCCTCTCAAGGGTGGCGACCGGCCCGAACCCATGGAC
ATTGACGACAAAGAAATGGGCGACTTTGAAGACGACTTTGAAGACGAGTTTGAGAGCGAAGACGAGATTTTCGAG
GCGGGAGTAGATGGGCGACCAGACGCCGAGCGAGAAGCTGAGGAAAAAGCCGCCACGGGCGTGGAGCAGAAAACT
TTTATAGTCGGGCGCACAAAACTCGAGCCGGGACAGACGCTGGCGCCGGACCTCTCGACATACAAGATGCTACAC
AACCTCAGCACTCCTTGGCCCTGTCTTTCATTTGACATTGTGGGCGACTCGCTGGGAGACAATCGCAAGGCCTAC
CCGGCCACCATGTACACGGTTGCCGGAACCCAGGCAGACTACTCCAAGACCAATGAGAATCAGCTCCTGGTCAGC
AAGCTGAGCGGGCTGAGCAGAATGGAACATGACGGAGACGAGGAATCAGATGACGACGACGACGACGAAGATGGC
GATCCGATTCTGGAGAGCAAGTCCATACCGCTCAACTCGACAACCAACCGCATACGCGCCCATCAGATTCCCAGC
TCGGAAGCAGGGAGACCGCCGACTACTCTCACAGCCACCATGACGGAATCAGGCAGCGTCTTTATCCATGACGTG
ACGCCGCATTTGGCGTCGTTTGACCAGCCGGGAATGGCAGTCACGGCGCAGCAGAACAAGCCCATCTCGACGATA
CGGGCGCACAAGGCAGAAGGATATGCTCTTGACTGGTCTCCTACGGTGGCTGGCAGCAAGCTGCTGACGGGCGAC
AACGACGGTATAATTTATATGACGATTCGAACCGACGGGGGAGGCTGGGTGACGGACTCGAGGCCTTTCCAAGGC
CACACGGGCAGCGTGGAGGAAATCCAGTGGTCGCCATCGGAGCAATTTGTCTTTGCATCGGCATCGAGCGACGGC
ACAGTACGCATCTGGGATGTGCGGTCCAAGGCGCGCAAGGCGGCCATTACAGTGCAGGCATCCAACAGCGACGTC
AATGTCATGTCGTGGTCGCGGCAAACGACACACCTGCTTGCATCCGGGGCGGATGACGGCGTCTGGGGCGTGTGG
GACTTGAGGCAGTGGAAGGCTGGGGCGGACAAGCCACAGCCGCTGGCGAGCTTCGACTTTCACAAGGAGCAGATT
ACGAGTCTAGAGTGGCATCCGACGGACGATTCCATCATGGCGGTGGCGGCAGGAGATAGCACGGTGACGCTCTGG
GACCTGGCAGTGGAGCTGGACGACGAGGAGAGCCGAGAGACGGCCGGGGTCAAGGATGTGCCGCCGCAGCTGCTC
TTTGTGCACTACCTCAAGGACGTCAAGGAGGTGCACTGGCACCCGCAAATACCGGGCAGTCTGATGGCGACGGGC
GAGGAATTCAGCGTCTTTAGGACGATAAGCGTGTGA
Gene >OphauG2|4591
ATGTCGAAGCGCACAGTCGACGTCAGTAACGGGCATGGCCCTCTCAAGGGTGGCGACCGGCCCGAACCCATGGAC
ATTGACGACAAAGAAATGGGCGACTTTGAAGACGACTTTGAAGACGAGTTTGAGAGCGAAGACGAGATTTTCGAG
GCGGGAGTAGATGGGCGACCAGACGCCGAGCGAGAAGCTGAGGAAAAAGCCGGTGAGTGTGTCAGTGCCATGATG
GTGATGACGACGACGATGGGCTCATGTTGTAACTTTTGCTCAGCCACGGGCGTGGAGCAGAAAACTTTTATAGTC
GGGCGCACAAAACTCGAGCCGGGACAGACGCTGGCGCCGGACCTCTCGACATACAAGATGCTACACAACCTCAGC
ACTCCTTGGCCCTGTCTTTCATTTGACATTGTGGGCGACTCGCTGGGAGACAATCGCAAGGCCTACCCGGCCACC
ATGTACACGGTTGCCGGAACCCAGGCAGACTACTCCAAGACCAATGAGAATCAGCTCCTGGTCAGCAAGCTGAGC
GGGCTGAGCAGAATGGAACATGACGGAGACGAGGAATCAGATGACGACGACGACGACGAAGATGGCGATCCGATT
CTGGAGAGCAAGTCCATACCGCTCAACTCGACAACCAACCGCATACGCGCCCATCAGATTCCCAGCTCGGAAGCA
GGGAGACCGCCGACTACTCTCACAGCCACCATGACGGAATCAGGCAGCGTCTTTATCCATGACGTGACGCCGCAT
TTGGCGTCGTTTGACCAGCCGGGAATGGCAGTCACGGCGCAGCAGAACAAGCCCATCTCGACGATACGGGCGCAC
AAGGCAGAAGGATATGCTCTTGACTGGTCTCCTACGGTGGCTGGCAGCAAGCTGCTGACGGGCGACAACGACGGT
ATAATTTATATGACGATTCGAACCGACGGGGGAGGCTGGGTGACGGACTCGAGGCCTTTCCAAGGCCACACGGGC
AGCGTGGAGGAAATCCAGTGGTCGCCATCGGAGCAATTTGTCTTTGCATCGGCATCGAGCGACGGCACAGTACGC
ATCTGGGATGTGCGGTCCAAGGCGCGCAAGGCGGCCATTACAGTGCAGGCATCCAACAGCGACGTCAATGTCATG
TCGTGGTCGCGGCAAACGACACACCTGCTTGCATCCGGGGCGGATGACGGCGTCTGGGGCGTGTGGGACTTGAGG
CAGTGGAAGGCTGGGGCGGACAAGCCACAGCCGCTGGCGAGCTTCGACTTTCACAAGGAGCAGATTACGAGTCTA
GAGTGGCATCCGACGGACGATTCCATCATGGCGGTGGCGGCAGGAGATAGCACGGTGACGCTCTGGGACCTGGCA
GTGGAGCTGGACGACGAGGAGAGCCGAGAGACGGCCGGGGTCAAGGATGTGCCGCCGCAGCTGCTCTTTGTGCAC
TACCTCAAGGACGTCAAGGAGGTGCACTGGCACCCGCAAATACCGGGCAGTCTGATGGCGACGGGCGAGGAATTC
AGCGTCTTTAGGACGATAAGCGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail