Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4585
Gene name
LocationContig_39:36268..36967
Strand+
Gene length (bp)699
Transcript length (bp)570
Coding sequence length (bp)570
Protein length (aa) 190

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04969 CS CS domain 7.0E-16 27 105

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17624|NUDC_EMENI Nuclear movement protein nudC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudC PE=3 SV=1 10 188 3.0E-74
sp|Q5ZIN1|NUDC_CHICK Nuclear migration protein nudC OS=Gallus gallus GN=NUDC PE=2 SV=1 24 189 5.0E-59
sp|Q63525|NUDC_RAT Nuclear migration protein nudC OS=Rattus norvegicus GN=Nudc PE=1 SV=1 24 189 3.0E-58
sp|O35685|NUDC_MOUSE Nuclear migration protein nudC OS=Mus musculus GN=Nudc PE=1 SV=1 24 189 5.0E-58
sp|Q9Y266|NUDC_HUMAN Nuclear migration protein nudC OS=Homo sapiens GN=NUDC PE=1 SV=1 24 189 8.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17624|NUDC_EMENI Nuclear movement protein nudC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudC PE=3 SV=1 10 188 3.0E-74
sp|Q5ZIN1|NUDC_CHICK Nuclear migration protein nudC OS=Gallus gallus GN=NUDC PE=2 SV=1 24 189 5.0E-59
sp|Q63525|NUDC_RAT Nuclear migration protein nudC OS=Rattus norvegicus GN=Nudc PE=1 SV=1 24 189 3.0E-58
sp|O35685|NUDC_MOUSE Nuclear migration protein nudC OS=Mus musculus GN=Nudc PE=1 SV=1 24 189 5.0E-58
sp|Q9Y266|NUDC_HUMAN Nuclear migration protein nudC OS=Homo sapiens GN=NUDC PE=1 SV=1 24 189 8.0E-58
sp|Q17QG2|NUDC_BOVIN Nuclear migration protein nudC OS=Bos taurus GN=NUDC PE=2 SV=1 24 189 3.0E-57
sp|Q9LV09|BOB1_ARATH Protein BOBBER 1 OS=Arabidopsis thaliana GN=BOB1 PE=1 SV=1 28 189 2.0E-48
sp|Q9STN7|BOB2_ARATH Protein BOBBER 2 OS=Arabidopsis thaliana GN=BOB2 PE=2 SV=1 28 189 8.0E-46
sp|O60166|NUDC_SCHPO Nuclear movement protein nudc OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nudc PE=3 SV=1 28 187 1.0E-38
sp|Q54M64|NUDC_DICDI Nuclear movement protein nudC OS=Dictyostelium discoideum GN=nudc PE=3 SV=1 17 189 3.0E-38
sp|Q8IVD9|NUDC3_HUMAN NudC domain-containing protein 3 OS=Homo sapiens GN=NUDCD3 PE=1 SV=3 28 173 5.0E-11
sp|Q5RB75|NUDC3_PONAB NudC domain-containing protein 3 OS=Pongo abelii GN=NUDCD3 PE=2 SV=1 28 173 6.0E-11
sp|Q8R1N4|NUDC3_MOUSE NudC domain-containing protein 3 OS=Mus musculus GN=Nudcd3 PE=1 SV=3 28 173 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2733
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4585 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|350
Ophiocordyceps camponoti-floridani Ophcf2|02589
Ophiocordyceps camponoti-rufipedis Ophun1|4153
Ophiocordyceps kimflemingae Ophio5|8054
Ophiocordyceps subramaniannii Hirsu2|4309

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4585
MADNKEPTPAQEAAARAKEVEEQAALPYKWVQTIGDVDITFTVPGNLASRDLAIDFKKQAICAGIKGQDPIIKGD
FPHAIHVDDSTWTLTSNADGSKTVEIHLDKINKMEWWAHVVKSAPQIDVTKIQPESSKLSDLDGETRGMVEKMMY
DQRQKEAGLPSSDEQKKMDILKKFQEQHPEMDFTKAKIN*
Coding >OphauG2|4585
ATGGCAGACAACAAAGAGCCCACTCCCGCCCAAGAGGCGGCCGCCCGCGCAAAGGAAGTTGAAGAACAGGCCGCC
CTGCCCTATAAATGGGTGCAGACGATAGGCGACGTCGACATCACCTTCACGGTTCCCGGCAACCTCGCATCGCGC
GACCTTGCCATCGATTTCAAGAAGCAGGCCATTTGTGCCGGTATCAAGGGTCAGGATCCCATCATCAAGGGCGAT
TTTCCCCATGCAATCCACGTCGACGACTCAACCTGGACCCTCACTTCCAACGCAGACGGCTCCAAGACTGTTGAG
ATCCACCTTGACAAGATCAACAAGATGGAATGGTGGGCCCACGTTGTAAAGTCTGCGCCCCAAATCGACGTTACC
AAGATTCAGCCCGAGTCATCCAAGCTATCGGACCTTGACGGTGAGACGCGTGGCATGGTGGAGAAAATGATGTAC
GACCAGCGCCAAAAAGAAGCTGGCCTGCCCTCGTCAGACGAGCAAAAGAAGATGGACATTCTCAAAAAGTTCCAG
GAGCAGCATCCAGAAATGGATTTCACCAAGGCCAAGATTAACTAG
Transcript >OphauG2|4585
ATGGCAGACAACAAAGAGCCCACTCCCGCCCAAGAGGCGGCCGCCCGCGCAAAGGAAGTTGAAGAACAGGCCGCC
CTGCCCTATAAATGGGTGCAGACGATAGGCGACGTCGACATCACCTTCACGGTTCCCGGCAACCTCGCATCGCGC
GACCTTGCCATCGATTTCAAGAAGCAGGCCATTTGTGCCGGTATCAAGGGTCAGGATCCCATCATCAAGGGCGAT
TTTCCCCATGCAATCCACGTCGACGACTCAACCTGGACCCTCACTTCCAACGCAGACGGCTCCAAGACTGTTGAG
ATCCACCTTGACAAGATCAACAAGATGGAATGGTGGGCCCACGTTGTAAAGTCTGCGCCCCAAATCGACGTTACC
AAGATTCAGCCCGAGTCATCCAAGCTATCGGACCTTGACGGTGAGACGCGTGGCATGGTGGAGAAAATGATGTAC
GACCAGCGCCAAAAAGAAGCTGGCCTGCCCTCGTCAGACGAGCAAAAGAAGATGGACATTCTCAAAAAGTTCCAG
GAGCAGCATCCAGAAATGGATTTCACCAAGGCCAAGATTAACTAG
Gene >OphauG2|4585
ATGGCAGACAACAAAGGTATGCATAGTCACAAGGCTCCGTCGTCACCCAGTTTCTAACATTTGCAGAGCCCACTC
CCGCCCAAGAGGCGGCCGCCCGCGCAAAGGAAGTTGAAGAACAGGCCGCCCTGCCCTATAAATGGGTGCAGACGA
TAGGCGACGTCGACATCACCTTCACGGTTCCCGGCAACCTCGCATCGCGCGACCTTGCCATCGATTTCAAGAAGC
AGGCCATTTGTGCCGGTATCAAGGGTCAGGATCCCATCATCAAGGTCGGTCGTGTCCGCTTTAGTCTATCTTTTC
GCACCAGTGCAAGAGCAAGGAACGCAAAATCTCACAGACTCACGATAGGGCGATTTTCCCCATGCAATCCACGTC
GACGACTCAACCTGGACCCTCACTTCCAACGCAGACGGCTCCAAGACTGTTGAGATCCACCTTGACAAGATCAAC
AAGATGGAATGGTGGGCCCACGTTGTAAAGTCTGCGCCCCAAATCGACGTTACCAAGATTCAGCCCGAGTCATCC
AAGCTATCGGACCTTGACGGTGAGACGCGTGGCATGGTGGAGAAAATGATGTACGACCAGCGCCAAAAAGAAGCT
GGCCTGCCCTCGTCAGACGAGCAAAAGAAGATGGACATTCTCAAAAAGTTCCAGGAGCAGCATCCAGAAATGGAT
TTCACCAAGGCCAAGATTAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail