Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4581
Gene name
LocationContig_39:28293..29984
Strand+
Gene length (bp)1691
Transcript length (bp)1614
Coding sequence length (bp)1614
Protein length (aa) 538

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 3.5E-23 32 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 23 239 3.0E-45
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 38 254 4.0E-30
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 22 269 7.0E-28
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 3 257 3.0E-26
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 22 257 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 23 239 3.0E-45
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 38 254 4.0E-30
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 22 269 7.0E-28
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 3 257 3.0E-26
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 22 257 2.0E-24
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 12 251 2.0E-23
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 50 246 6.0E-23
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 50 241 3.0E-22
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 15 146 2.0E-20
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 11 146 6.0E-20
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 50 241 1.0E-19
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 11 146 2.0E-19
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 11 146 2.0E-19
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 11 146 3.0E-19
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 50 241 7.0E-19
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 28 135 3.0E-18
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 13 243 5.0E-18
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 27 138 7.0E-18
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 34 245 1.0E-17
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 23 220 5.0E-17
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 28 138 1.0E-16
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 14 241 2.0E-16
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 31 138 3.0E-16
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 7 187 4.0E-16
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 50 241 4.0E-16
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 29 245 4.0E-16
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 14 129 9.0E-16
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 31 138 1.0E-15
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 37 241 1.0E-15
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 19 220 2.0E-15
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 31 138 3.0E-15
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 28 162 3.0E-15
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 51 168 3.0E-15
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 51 170 3.0E-15
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 19 220 3.0E-15
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 51 170 4.0E-15
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 51 170 4.0E-15
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 51 168 4.0E-15
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 51 168 7.0E-15
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 26 145 9.0E-15
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 26 145 9.0E-15
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 26 145 9.0E-15
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 26 145 2.0E-14
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 26 145 2.0E-14
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 22 220 2.0E-14
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 6 135 4.0E-14
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 28 242 4.0E-14
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 26 154 6.0E-14
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 31 146 6.0E-14
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 51 142 6.0E-14
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 31 111 7.0E-14
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 22 220 7.0E-14
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 19 228 8.0E-14
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 29 187 1.0E-13
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 51 143 1.0E-13
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 6 146 1.0E-13
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 22 220 1.0E-13
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 31 143 2.0E-13
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 28 245 2.0E-13
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 28 146 3.0E-13
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 51 143 3.0E-13
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 26 138 4.0E-13
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 43 245 5.0E-13
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 13 158 5.0E-13
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 32 143 6.0E-13
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 7 129 1.0E-12
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 28 146 3.0E-12
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 29 245 3.0E-12
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 49 146 4.0E-12
sp|Q6ZRP7|QSOX2_HUMAN Sulfhydryl oxidase 2 OS=Homo sapiens GN=QSOX2 PE=1 SV=3 31 248 5.0E-12
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 28 242 6.0E-12
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 32 114 9.0E-12
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 29 130 2.0E-11
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 30 138 2.0E-11
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 30 138 2.0E-11
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 25 256 2.0E-11
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 30 138 3.0E-11
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 49 244 3.0E-11
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 31 113 3.0E-11
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 30 138 4.0E-11
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 26 134 4.0E-11
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 26 138 4.0E-11
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 28 134 4.0E-11
sp|Q3TMX7|QSOX2_MOUSE Sulfhydryl oxidase 2 OS=Mus musculus GN=Qsox2 PE=1 SV=1 22 225 5.0E-11
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 30 131 7.0E-11
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 28 131 7.0E-11
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 33 114 9.0E-11
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 33 114 9.0E-11
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 30 131 1.0E-10
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 31 245 1.0E-10
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 51 152 1.0E-10
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 28 113 1.0E-10
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 51 130 1.0E-10
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 26 134 2.0E-10
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 26 153 2.0E-10
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 51 130 2.0E-10
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 51 130 2.0E-10
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 28 113 2.0E-10
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 27 152 2.0E-10
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 31 113 2.0E-10
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 28 113 2.0E-10
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 31 245 2.0E-10
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 30 131 3.0E-10
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 30 131 3.0E-10
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 30 131 3.0E-10
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 30 141 3.0E-10
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 31 113 3.0E-10
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 28 113 3.0E-10
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 31 114 3.0E-10
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 28 134 3.0E-10
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 29 119 3.0E-10
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 28 134 3.0E-10
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 28 134 3.0E-10
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 28 131 4.0E-10
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 31 240 4.0E-10
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 36 135 5.0E-10
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 28 131 5.0E-10
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 26 138 6.0E-10
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 28 131 6.0E-10
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 11 129 6.0E-10
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 51 146 6.0E-10
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 28 134 6.0E-10
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 51 142 6.0E-10
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 51 146 7.0E-10
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 51 146 7.0E-10
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 31 245 8.0E-10
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 51 152 8.0E-10
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 46 245 8.0E-10
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 20 138 1.0E-09
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 31 130 1.0E-09
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 49 130 1.0E-09
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 51 130 1.0E-09
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 31 119 1.0E-09
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 28 131 1.0E-09
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 51 152 1.0E-09
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 43 114 1.0E-09
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 27 134 2.0E-09
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 30 130 2.0E-09
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 28 111 2.0E-09
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 49 130 2.0E-09
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 31 130 2.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 51 109 2.0E-09
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 51 152 2.0E-09
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 28 131 2.0E-09
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 31 114 2.0E-09
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 29 138 2.0E-09
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 43 114 2.0E-09
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 27 114 2.0E-09
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 9 119 3.0E-09
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 6 113 3.0E-09
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 27 130 3.0E-09
sp|Q6AX23|QSOX2_XENLA Sulfhydryl oxidase 2 OS=Xenopus laevis GN=qsox2 PE=2 SV=1 24 237 3.0E-09
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 27 130 3.0E-09
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 33 114 3.0E-09
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 51 150 4.0E-09
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 51 229 5.0E-09
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 51 194 5.0E-09
sp|Q9XGS0|TRXM_BRANA Thioredoxin M-type, chloroplastic OS=Brassica napus PE=1 SV=1 33 113 6.0E-09
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 32 125 7.0E-09
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 30 138 8.0E-09
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 31 119 8.0E-09
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 31 119 8.0E-09
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 31 119 8.0E-09
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 31 119 8.0E-09
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 31 119 8.0E-09
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 31 119 8.0E-09
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 34 134 9.0E-09
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 51 179 9.0E-09
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 43 114 9.0E-09
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 43 138 1.0E-08
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 32 114 1.0E-08
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 53 114 1.0E-08
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 50 134 1.0E-08
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 30 130 2.0E-08
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 51 142 2.0E-08
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 33 119 2.0E-08
sp|Q9SEU8|TRXM2_ARATH Thioredoxin M2, chloroplastic OS=Arabidopsis thaliana GN=At4g03520 PE=1 SV=2 34 114 2.0E-08
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 49 114 2.0E-08
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 49 114 2.0E-08
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 31 226 2.0E-08
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 43 119 2.0E-08
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 38 123 3.0E-08
sp|Q9SEU6|TRXM4_ARATH Thioredoxin M4, chloroplastic OS=Arabidopsis thaliana GN=At3g15360 PE=2 SV=2 43 114 3.0E-08
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 43 114 3.0E-08
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 43 114 3.0E-08
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 43 114 3.0E-08
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 43 114 3.0E-08
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 31 245 4.0E-08
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 51 135 4.0E-08
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 36 245 5.0E-08
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 49 152 5.0E-08
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 10 138 7.0E-08
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 31 138 8.0E-08
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 42 114 9.0E-08
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 51 141 1.0E-07
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 51 115 1.0E-07
sp|Q92JR5|THIO_RICCN Thioredoxin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxA PE=3 SV=1 37 123 1.0E-07
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 43 114 1.0E-07
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 27 114 1.0E-07
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 43 119 1.0E-07
sp|P09857|THIO_ALLVI Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 31 119 1.0E-07
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 49 138 1.0E-07
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 30 113 2.0E-07
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 21 138 2.0E-07
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 28 134 2.0E-07
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 43 117 2.0E-07
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 51 209 2.0E-07
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 21 114 2.0E-07
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 31 114 2.0E-07
sp|Q7XKD0|TRXX_ORYSJ Thioredoxin X, chloroplastic OS=Oryza sativa subsp. japonica GN=TRX-X PE=2 SV=1 43 114 2.0E-07
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 51 138 2.0E-07
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 31 119 2.0E-07
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 31 245 3.0E-07
sp|P08058|THIO_RHOSH Thioredoxin OS=Rhodobacter sphaeroides GN=trxA PE=1 SV=3 43 114 3.0E-07
sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 31 114 3.0E-07
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 34 114 3.0E-07
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 38 119 3.0E-07
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 49 138 4.0E-07
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 51 131 5.0E-07
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 31 141 6.0E-07
sp|O48737|TRXM1_ARATH Thioredoxin M1, chloroplastic OS=Arabidopsis thaliana GN=At1g03680 PE=2 SV=1 20 122 6.0E-07
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 6 139 8.0E-07
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 51 164 1.0E-06
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 31 112 1.0E-06
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 31 112 1.0E-06
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 51 125 1.0E-06
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 31 114 1.0E-06
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 51 125 1.0E-06
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 31 114 1.0E-06
sp|Q68Y00|THIO_RICTY Thioredoxin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxA PE=3 SV=1 38 142 1.0E-06
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 31 114 1.0E-06
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 51 125 1.0E-06
sp|Q9LKW0|CITRX_SOLLC Thioredoxin-like protein CITRX, chloroplastic OS=Solanum lycopersicum GN=CITRX PE=1 SV=1 47 142 1.0E-06
sp|M1A3D5|CITRX_SOLTU Thioredoxin-like protein CITRX, chloroplastic OS=Solanum tuberosum GN=CITRX PE=3 SV=1 47 142 1.0E-06
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 51 177 1.0E-06
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 30 145 2.0E-06
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 31 213 2.0E-06
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 43 117 2.0E-06
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 31 118 2.0E-06
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 31 114 2.0E-06
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 32 130 3.0E-06
sp|P0A0K5|THIO_STAAW Thioredoxin OS=Staphylococcus aureus (strain MW2) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|P0A0K6|THIO_STAAU Thioredoxin OS=Staphylococcus aureus GN=trxA PE=1 SV=1 49 136 3.0E-06
sp|Q6GA69|THIO_STAAS Thioredoxin OS=Staphylococcus aureus (strain MSSA476) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|Q6GHU0|THIO_STAAR Thioredoxin OS=Staphylococcus aureus (strain MRSA252) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|P99122|THIO_STAAN Thioredoxin OS=Staphylococcus aureus (strain N315) GN=trxA PE=1 SV=1 49 136 3.0E-06
sp|P0A0K4|THIO_STAAM Thioredoxin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|Q5HGT9|THIO_STAAC Thioredoxin OS=Staphylococcus aureus (strain COL) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|Q2YXD0|THIO_STAAB Thioredoxin OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|Q2FZD2|THIO_STAA8 Thioredoxin OS=Staphylococcus aureus (strain NCTC 8325) GN=trxA PE=2 SV=1 49 136 3.0E-06
sp|Q2FHT6|THIO_STAA3 Thioredoxin OS=Staphylococcus aureus (strain USA300) GN=trxA PE=3 SV=1 49 136 3.0E-06
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 31 123 4.0E-06
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 46 114 5.0E-06
sp|O51088|THIO_BORBU Thioredoxin OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxA PE=3 SV=1 45 107 7.0E-06
sp|Q6JE38|CITX1_NICBE Thioredoxin-like protein CITRX1, chloroplastic OS=Nicotiana benthamiana GN=CITRX1 PE=2 SV=1 47 142 8.0E-06
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 34 114 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4581
MHHHSLAAAAAALLATLPACQAAMYTKKSPVLQIDANSYGPLIAKSNYTSIIEFYAPWCGHCQNLKPIYEKLAEK
LQGRAKVAAVDCDDDGNKQFCGHHGVKGFPTLKIVRPGKGPASKPTVQDYQGQRTVKSMADAVLNSINNHVIRVT
DEKLDAFIASKEPKALLFTEKGTTSGLLRSIAIDFLGVIKIGQVRDKDTAVVEKFGIDKFPTLILIPGDGEDAIV
YHGELNKEEMVKFLSQAGQPNPDPAPVEKAKGDGPSSNKASKASDEKKSKTSDEKKKKKNKVSDKSSDKAQAETS
SASPTKESTPDPEESAETSTASETAESTRPSADIISITTVDTKAMVVEKCLKPKSHSCVLAFIPSKSSEGGDKVL
AALSHLNTKYIHGKRHVFPFLALPDNIDGSAMLRETLNLGNEVEMIALNARRLWWKRYEGDFSHESVENWIDSIR
MGEGKKSDLPETVLDKAEDMAHNGSQATEADSSTKSEEDSTAQSPTTESSTSQTLTEATQATDPQPESETQKSET
QKSEEEVVHEEL*
Coding >OphauG2|4581
ATGCACCATCACTCCCTCGCCGCTGCCGCCGCCGCGCTGCTGGCTACGCTGCCTGCTTGTCAGGCTGCAATGTAC
ACCAAGAAGTCGCCCGTCTTACAGATTGATGCAAACTCATACGGGCCGCTCATTGCAAAGTCTAACTATACTTCG
ATTATCGAGTTCTACGCGCCCTGGTGCGGCCATTGCCAGAATCTCAAGCCCATCTACGAAAAGCTTGCCGAAAAA
CTCCAAGGCCGTGCCAAAGTTGCCGCCGTCGACTGTGACGACGATGGAAATAAGCAGTTCTGCGGCCATCATGGA
GTCAAAGGTTTTCCCACGCTCAAGATTGTGCGGCCTGGCAAGGGGCCTGCATCCAAGCCCACTGTCCAAGATTAT
CAGGGCCAGCGCACTGTCAAGAGCATGGCTGATGCCGTGCTTAATAGCATCAACAACCACGTCATTCGTGTCACC
GACGAGAAACTTGATGCATTCATTGCAAGTAAAGAACCCAAAGCCTTGTTGTTTACAGAAAAGGGTACCACGAGC
GGCCTTCTGCGCTCAATAGCAATCGACTTTCTTGGTGTCATCAAGATCGGTCAGGTCCGCGACAAGGACACGGCC
GTGGTGGAAAAGTTTGGCATAGACAAGTTTCCCACCTTGATTCTCATCCCTGGCGACGGTGAAGATGCCATCGTT
TACCATGGCGAGCTGAACAAGGAAGAAATGGTCAAATTCCTTTCGCAAGCTGGACAGCCAAACCCTGACCCTGCA
CCTGTCGAGAAAGCCAAGGGTGACGGGCCGAGTAGCAATAAGGCATCCAAGGCGTCTGATGAGAAGAAGAGCAAG
ACGTCTGACGAGAAGAAGAAGAAGAAGAACAAGGTGTCAGACAAGAGCTCGGATAAGGCCCAAGCTGAGACTTCA
AGTGCCTCTCCTACAAAAGAGAGCACTCCCGATCCCGAAGAATCAGCAGAGACCTCTACCGCATCAGAAACAGCC
GAATCTACAAGACCGAGTGCAGATATTATTTCAATCACAACCGTCGATACCAAGGCAATGGTGGTAGAGAAATGT
CTCAAGCCCAAATCTCATTCATGCGTCCTGGCCTTCATTCCTTCCAAATCGTCAGAGGGAGGAGACAAGGTTCTT
GCAGCGCTATCGCATCTCAACACCAAGTATATTCATGGCAAGAGACATGTTTTCCCGTTCTTAGCCTTGCCCGAT
AACATTGACGGCTCCGCAATGTTGCGCGAAACTCTTAACCTTGGTAACGAGGTCGAGATGATAGCCCTCAACGCG
CGCCGTCTGTGGTGGAAGAGATATGAGGGTGACTTCAGTCACGAGAGTGTGGAGAACTGGATCGACTCCATCAGA
ATGGGAGAAGGTAAGAAGAGCGACTTGCCCGAGACGGTGTTGGACAAGGCAGAAGATATGGCCCACAATGGTTCG
CAGGCGACAGAAGCAGATTCGAGCACCAAGAGTGAAGAGGACTCGACAGCTCAGAGTCCCACTACGGAAAGTTCT
ACATCCCAGACTTTGACAGAGGCGACTCAGGCAACAGACCCACAACCAGAGTCTGAGACGCAGAAGTCTGAGACG
CAGAAGTCTGAGGAAGAAGTAGTGCATGAGGAGCTCTGA
Transcript >OphauG2|4581
ATGCACCATCACTCCCTCGCCGCTGCCGCCGCCGCGCTGCTGGCTACGCTGCCTGCTTGTCAGGCTGCAATGTAC
ACCAAGAAGTCGCCCGTCTTACAGATTGATGCAAACTCATACGGGCCGCTCATTGCAAAGTCTAACTATACTTCG
ATTATCGAGTTCTACGCGCCCTGGTGCGGCCATTGCCAGAATCTCAAGCCCATCTACGAAAAGCTTGCCGAAAAA
CTCCAAGGCCGTGCCAAAGTTGCCGCCGTCGACTGTGACGACGATGGAAATAAGCAGTTCTGCGGCCATCATGGA
GTCAAAGGTTTTCCCACGCTCAAGATTGTGCGGCCTGGCAAGGGGCCTGCATCCAAGCCCACTGTCCAAGATTAT
CAGGGCCAGCGCACTGTCAAGAGCATGGCTGATGCCGTGCTTAATAGCATCAACAACCACGTCATTCGTGTCACC
GACGAGAAACTTGATGCATTCATTGCAAGTAAAGAACCCAAAGCCTTGTTGTTTACAGAAAAGGGTACCACGAGC
GGCCTTCTGCGCTCAATAGCAATCGACTTTCTTGGTGTCATCAAGATCGGTCAGGTCCGCGACAAGGACACGGCC
GTGGTGGAAAAGTTTGGCATAGACAAGTTTCCCACCTTGATTCTCATCCCTGGCGACGGTGAAGATGCCATCGTT
TACCATGGCGAGCTGAACAAGGAAGAAATGGTCAAATTCCTTTCGCAAGCTGGACAGCCAAACCCTGACCCTGCA
CCTGTCGAGAAAGCCAAGGGTGACGGGCCGAGTAGCAATAAGGCATCCAAGGCGTCTGATGAGAAGAAGAGCAAG
ACGTCTGACGAGAAGAAGAAGAAGAAGAACAAGGTGTCAGACAAGAGCTCGGATAAGGCCCAAGCTGAGACTTCA
AGTGCCTCTCCTACAAAAGAGAGCACTCCCGATCCCGAAGAATCAGCAGAGACCTCTACCGCATCAGAAACAGCC
GAATCTACAAGACCGAGTGCAGATATTATTTCAATCACAACCGTCGATACCAAGGCAATGGTGGTAGAGAAATGT
CTCAAGCCCAAATCTCATTCATGCGTCCTGGCCTTCATTCCTTCCAAATCGTCAGAGGGAGGAGACAAGGTTCTT
GCAGCGCTATCGCATCTCAACACCAAGTATATTCATGGCAAGAGACATGTTTTCCCGTTCTTAGCCTTGCCCGAT
AACATTGACGGCTCCGCAATGTTGCGCGAAACTCTTAACCTTGGTAACGAGGTCGAGATGATAGCCCTCAACGCG
CGCCGTCTGTGGTGGAAGAGATATGAGGGTGACTTCAGTCACGAGAGTGTGGAGAACTGGATCGACTCCATCAGA
ATGGGAGAAGGTAAGAAGAGCGACTTGCCCGAGACGGTGTTGGACAAGGCAGAAGATATGGCCCACAATGGTTCG
CAGGCGACAGAAGCAGATTCGAGCACCAAGAGTGAAGAGGACTCGACAGCTCAGAGTCCCACTACGGAAAGTTCT
ACATCCCAGACTTTGACAGAGGCGACTCAGGCAACAGACCCACAACCAGAGTCTGAGACGCAGAAGTCTGAGACG
CAGAAGTCTGAGGAAGAAGTAGTGCATGAGGAGCTCTGA
Gene >OphauG2|4581
ATGCACCATCACTCCCTCGCCGCTGCCGCCGCCGCGCTGCTGGCTACGCTGCCTGCTTGTCAGGCTGCAATGTAC
ACCAAGAAGTCGCCCGTCTTACAGATTGATGCAAACTCATACGGGCCGCTCATTGCAAAGTCTAACTATACTTCG
GTAAGCCTTTACAGTAGACTACAGTAGAGCCGCACTATATCCTCGGCCCTATTTGCCTTTGACTAACCCAATTCT
AGATTATCGAGTTCTACGCGCCCTGGTGCGGCCATTGCCAGAATCTCAAGCCCATCTACGAAAAGCTTGCCGAAA
AACTCCAAGGCCGTGCCAAAGTTGCCGCCGTCGACTGTGACGACGATGGAAATAAGCAGTTCTGCGGCCATCATG
GAGTCAAAGGTTTTCCCACGCTCAAGATTGTGCGGCCTGGCAAGGGGCCTGCATCCAAGCCCACTGTCCAAGATT
ATCAGGGCCAGCGCACTGTCAAGAGCATGGCTGATGCCGTGCTTAATAGCATCAACAACCACGTCATTCGTGTCA
CCGACGAGAAACTTGATGCATTCATTGCAAGTAAAGAACCCAAAGCCTTGTTGTTTACAGAAAAGGGTACCACGA
GCGGCCTTCTGCGCTCAATAGCAATCGACTTTCTTGGTGTCATCAAGATCGGTCAGGTCCGCGACAAGGACACGG
CCGTGGTGGAAAAGTTTGGCATAGACAAGTTTCCCACCTTGATTCTCATCCCTGGCGACGGTGAAGATGCCATCG
TTTACCATGGCGAGCTGAACAAGGAAGAAATGGTCAAATTCCTTTCGCAAGCTGGACAGCCAAACCCTGACCCTG
CACCTGTCGAGAAAGCCAAGGGTGACGGGCCGAGTAGCAATAAGGCATCCAAGGCGTCTGATGAGAAGAAGAGCA
AGACGTCTGACGAGAAGAAGAAGAAGAAGAACAAGGTGTCAGACAAGAGCTCGGATAAGGCCCAAGCTGAGACTT
CAAGTGCCTCTCCTACAAAAGAGAGCACTCCCGATCCCGAAGAATCAGCAGAGACCTCTACCGCATCAGAAACAG
CCGAATCTACAAGACCGAGTGCAGATATTATTTCAATCACAACCGTCGATACCAAGGCAATGGTGGTAGAGAAAT
GTCTCAAGCCCAAATCTCATTCATGCGTCCTGGCCTTCATTCCTTCCAAATCGTCAGAGGGAGGAGACAAGGTTC
TTGCAGCGCTATCGCATCTCAACACCAAGTATATTCATGGCAAGAGACATGTTTTCCCGTTCTTAGCCTTGCCCG
ATAACATTGACGGCTCCGCAATGTTGCGCGAAACTCTTAACCTTGGTAACGAGGTCGAGATGATAGCCCTCAACG
CGCGCCGTCTGTGGTGGAAGAGATATGAGGGTGACTTCAGTCACGAGAGTGTGGAGAACTGGATCGACTCCATCA
GAATGGGAGAAGGTAAGAAGAGCGACTTGCCCGAGACGGTGTTGGACAAGGCAGAAGATATGGCCCACAATGGTT
CGCAGGCGACAGAAGCAGATTCGAGCACCAAGAGTGAAGAGGACTCGACAGCTCAGAGTCCCACTACGGAAAGTT
CTACATCCCAGACTTTGACAGAGGCGACTCAGGCAACAGACCCACAACCAGAGTCTGAGACGCAGAAGTCTGAGA
CGCAGAAGTCTGAGGAAGAAGTAGTGCATGAGGAGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail