Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4564
Gene name
LocationContig_389:5430..8625
Strand+
Gene length (bp)3195
Transcript length (bp)2979
Coding sequence length (bp)2979
Protein length (aa) 993

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03914 CBF CBF/Mak21 family 6.7E-49 593 747

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12176|MAK21_YEAST Ribosome biogenesis protein MAK21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK21 PE=1 SV=1 213 990 4.0E-154
sp|O36021|YEK9_SCHPO Uncharacterized protein C4F10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.09c PE=1 SV=1 169 985 1.0E-148
sp|P53569|CEBPZ_MOUSE CCAAT/enhancer-binding protein zeta OS=Mus musculus GN=Cebpz PE=1 SV=2 180 866 1.0E-102
sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens GN=CEBPZ PE=1 SV=3 50 988 7.0E-98
sp|Q19753|YU0O_CAEEL Uncharacterized protein F23B12.7 OS=Caenorhabditis elegans GN=F23B12.7 PE=3 SV=1 211 681 6.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12176|MAK21_YEAST Ribosome biogenesis protein MAK21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK21 PE=1 SV=1 213 990 4.0E-154
sp|O36021|YEK9_SCHPO Uncharacterized protein C4F10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.09c PE=1 SV=1 169 985 1.0E-148
sp|P53569|CEBPZ_MOUSE CCAAT/enhancer-binding protein zeta OS=Mus musculus GN=Cebpz PE=1 SV=2 180 866 1.0E-102
sp|Q03701|CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens GN=CEBPZ PE=1 SV=3 50 988 7.0E-98
sp|Q19753|YU0O_CAEEL Uncharacterized protein F23B12.7 OS=Caenorhabditis elegans GN=F23B12.7 PE=3 SV=1 211 681 6.0E-38
sp|Q19753|YU0O_CAEEL Uncharacterized protein F23B12.7 OS=Caenorhabditis elegans GN=F23B12.7 PE=3 SV=1 712 859 1.0E-10
sp|Q6DRN3|NOC3L_DANRE Nucleolar complex protein 3 homolog OS=Danio rerio GN=noc3l PE=2 SV=1 551 751 6.0E-10
sp|Q4VBT2|NOC4L_DANRE Nucleolar complex protein 4 homolog OS=Danio rerio GN=noc4l PE=2 SV=1 607 750 9.0E-09
sp|Q8VI84|NOC3L_MOUSE Nucleolar complex protein 3 homolog OS=Mus musculus GN=Noc3l PE=2 SV=2 551 751 3.0E-08
sp|Q91Y26|NOC3L_CRIGR Nucleolar complex protein 3 homolog OS=Cricetulus griseus GN=NOC3L PE=2 SV=1 551 751 3.0E-08
sp|Q5I0I8|NOC4L_RAT Nucleolar complex protein 4 homolog OS=Rattus norvegicus GN=Noc4l PE=2 SV=1 592 750 4.0E-08
sp|Q8BHY2|NOC4L_MOUSE Nucleolar complex protein 4 homolog OS=Mus musculus GN=Noc4l PE=2 SV=1 592 750 4.0E-08
sp|Q5R952|NOC3L_PONAB Nucleolar complex protein 3 homolog OS=Pongo abelii GN=NOC3L PE=2 SV=1 551 751 1.0E-07
sp|Q8WTT2|NOC3L_HUMAN Nucleolar complex protein 3 homolog OS=Homo sapiens GN=NOC3L PE=1 SV=1 551 751 3.0E-07
sp|Q06512|NOC4_YEAST Nucleolar complex protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC4 PE=1 SV=1 586 786 3.0E-07
sp|Q5XGZ8|NOC3L_XENLA Nucleolar complex protein 3 homolog OS=Xenopus laevis GN=noc3l PE=2 SV=1 607 750 4.0E-07
sp|Q9BVI4|NOC4L_HUMAN Nucleolar complex protein 4 homolog OS=Homo sapiens GN=NOC4L PE=1 SV=1 607 750 5.0E-07
sp|Q9VI82|NOC3L_DROME Nucleolar complex protein 3 homolog OS=Drosophila melanogaster GN=CG1234 PE=1 SV=1 550 750 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4564
MPNPSKKPHGPRAPSNGKEAKPQGFAQLQSKIEKSLSNSELKKKRKKPPASASEKPEPKRQRPTRDAPSKSLTKK
SSKANNHADEAALLAEIKALGGDESDLHLINHVDSDDQVEAPHAKHKVDKRLKDELAALSNQLGFANARLDDDSS
QDGHLQQGSQDEGHEQHQDQGPRAAKANSKNMTFEPLADWHASGLASLPNPASDQAAPFMSVVESLREQALTYLE
EDAAKYKTSIFASSSHKFLATIMSSGTLTDKVSALTLAIQESPVHNTRALDALMNLASKRSRAQAIGAIGALVDL
FGPGALLPADRRLRTFQSQPGLLGTLQKHSVKTWAPHQPLPGSLTKAHLIAWVYEDWLKETYFKLIQLLEVWCAD
EIEFSRTKALDFVYALLKDKPEQEANLLTLLVNKLGDRDGKISSRASYLLLQLQVSHPGMKPIIIRAIEQGILVH
PSLDTRPKYYAINTLNQTILSSKEPGVAESLIRIYFHLFVTLLKGGSLGFSLDQASGHAKESSKKQDRQDKRAKQ
PPAKGKYGKPPAAKPLAPETESADKLVSAILTGVNRAAPFVGANDAILETHLDTLFKIAHSANLNTGIQALLLIQ
HLSSARNLATDRFYRTLYESLLDPRLVTSSKQALYLNLLLRALKSDIDVRRVKAFVKRMLQISNLHQPSFVCGLL
YIVSQLWQTFPDLATLVEEPEASAFDDDEALNQDGRYDGRKRDPEHCNAQGSCLWELIPVMAHFHPSVSVYATAL
LDKERKLHKPDLESHTLIRFLDKFVYKNPKTADTSRGTSIMQPLRAAKDGGNTWLGSRSAGSSATFVNSAAFWSK
KADEVAAQDVFFHQYFQHLPGGPAKKQKKKQPGETSAHDSDKGGGDDDDDDDDDEIWKALVSTRPEITGDGSVDG
FDDLDELDMASEDDGSSPALSLDSDMDSDDQDDFASDQAADDGLVAVAEADQDEADEGKSKKKSRRRALKALPMF
ASVEDYAELLAQDEDGN*
Coding >OphauG2|4564
ATGCCAAACCCGTCAAAAAAGCCCCATGGCCCTCGCGCCCCGTCAAATGGAAAAGAAGCCAAGCCCCAAGGCTTC
GCACAGCTCCAATCCAAGATTGAAAAGAGTCTGAGCAACAGCGAGCTGAAAAAGAAGCGCAAGAAGCCTCCCGCC
AGCGCCTCGGAAAAGCCAGAGCCTAAGCGGCAGCGCCCGACTCGCGACGCACCGTCCAAGAGCCTGACAAAAAAG
AGCTCCAAGGCCAACAACCATGCTGATGAGGCGGCGCTGCTGGCGGAAATCAAGGCCTTGGGAGGAGACGAGTCC
GACTTGCATCTCATCAACCATGTCGATTCGGACGACCAGGTTGAGGCACCACATGCGAAGCACAAGGTCGACAAA
CGTCTCAAGGATGAGCTTGCAGCGCTCTCCAACCAGTTGGGCTTTGCCAATGCCAGGCTAGATGACGACAGTAGC
CAAGACGGCCACCTCCAGCAAGGCAGCCAAGACGAGGGCCATGAGCAGCATCAGGACCAGGGTCCTCGGGCGGCA
AAGGCCAACAGCAAAAACATGACCTTTGAGCCTCTAGCAGACTGGCACGCGTCGGGCCTCGCCAGCCTCCCAAAT
CCAGCCTCTGACCAAGCCGCCCCCTTTATGTCCGTCGTGGAGTCGCTCAGGGAGCAAGCCCTCACATATCTGGAA
GAGGACGCGGCCAAGTATAAGACGAGCATCTTTGCCTCGTCGTCACACAAGTTCTTGGCGACAATCATGTCTTCA
GGCACCCTTACAGACAAGGTGTCTGCTCTGACACTGGCCATACAAGAGTCGCCTGTCCACAACACGCGAGCCCTC
GATGCCCTCATGAACCTGGCTTCCAAGAGAAGCCGTGCTCAAGCCATTGGAGCCATTGGAGCTCTAGTCGACCTT
TTCGGCCCAGGGGCGCTTTTGCCCGCAGACCGACGACTACGCACTTTCCAAAGCCAGCCCGGCCTGTTGGGCACC
CTGCAAAAGCACTCGGTAAAGACATGGGCTCCTCACCAGCCTCTCCCTGGCAGCTTGACCAAGGCTCACCTCATT
GCCTGGGTCTACGAAGACTGGCTCAAGGAAACCTACTTCAAGCTCATACAGCTGCTCGAGGTGTGGTGTGCCGAT
GAGATTGAATTTTCTCGCACCAAGGCCCTTGACTTTGTCTACGCCCTGCTCAAAGACAAGCCCGAGCAAGAGGCC
AATTTGCTCACTCTTCTCGTCAACAAGCTAGGCGATAGAGATGGAAAGATTTCTTCCCGAGCCTCGTACCTTCTC
CTGCAGCTGCAGGTGTCTCATCCCGGCATGAAGCCCATCATTATCCGTGCCATTGAGCAGGGCATTCTTGTCCAT
CCATCACTGGACACGCGGCCAAAGTACTACGCAATCAATACTTTGAACCAGACAATTCTCAGCAGCAAGGAACCA
GGCGTAGCCGAATCCCTCATTCGTATATATTTCCACCTTTTTGTAACCCTGCTAAAGGGGGGGAGCCTTGGCTTT
TCGCTCGACCAAGCATCTGGCCATGCAAAAGAGTCGTCCAAGAAACAGGACAGGCAAGACAAGAGAGCCAAGCAA
CCGCCGGCAAAGGGGAAATATGGCAAGCCCCCAGCCGCCAAGCCCCTGGCGCCAGAGACAGAGTCGGCCGACAAG
CTCGTTTCTGCAATCCTTACTGGAGTTAATCGAGCAGCGCCATTCGTGGGCGCCAATGATGCCATCTTGGAAACA
CACCTCGACACGCTCTTCAAGATTGCCCACTCGGCCAACCTCAACACTGGTATTCAGGCCCTGCTCTTGATTCAA
CACCTCTCATCGGCAAGAAATCTAGCAACAGACCGATTCTACCGCACGCTGTACGAGTCGTTGTTGGACCCGCGG
CTCGTGACGTCGTCGAAGCAGGCACTCTATCTCAACCTGCTGCTTCGAGCCCTCAAGAGCGACATTGATGTGCGG
AGGGTCAAGGCTTTCGTCAAGAGGATGCTACAGATATCCAACCTGCACCAGCCGTCATTTGTGTGTGGTTTGCTC
TACATTGTCTCCCAACTGTGGCAGACATTTCCCGACCTGGCAACCTTGGTGGAAGAGCCAGAAGCGTCTGCCTTT
GACGATGATGAGGCCTTGAATCAAGACGGGCGGTACGATGGGCGCAAACGCGATCCTGAGCACTGCAATGCACAG
GGCAGTTGTCTGTGGGAGCTGATTCCAGTCATGGCGCATTTTCACCCTTCAGTCAGTGTCTATGCCACAGCGCTA
CTGGACAAGGAGCGCAAACTGCATAAGCCGGACCTGGAGAGCCATACGCTCATCAGATTTCTCGACAAGTTTGTG
TACAAGAACCCCAAGACGGCCGACACTAGTCGCGGCACGTCAATCATGCAGCCTCTGCGGGCGGCCAAGGACGGG
GGCAACACATGGCTGGGCAGCAGAAGCGCAGGCAGTTCGGCAACCTTTGTCAACTCGGCGGCCTTTTGGAGCAAA
AAGGCAGACGAGGTTGCTGCTCAAGACGTCTTTTTCCACCAATACTTTCAGCACTTGCCCGGGGGGCCAGCCAAG
AAGCAGAAGAAGAAACAGCCCGGTGAGACGAGTGCACACGACAGCGACAAGGGCGGCGGCGATGACGACGACGAC
GACGACGACGACGAGATTTGGAAGGCACTTGTGTCGACGCGGCCAGAGATTACAGGCGACGGGTCGGTAGATGGG
TTTGACGATTTGGACGAGCTGGACATGGCGTCAGAGGATGATGGCTCGTCGCCAGCCCTGTCCTTGGACAGCGAC
ATGGACAGCGATGACCAAGATGATTTTGCATCGGATCAAGCGGCAGACGATGGCTTGGTGGCGGTTGCAGAGGCC
GACCAAGACGAGGCAGACGAGGGGAAAAGCAAGAAGAAGTCGAGGAGGCGGGCGCTCAAGGCCCTGCCCATGTTT
GCGTCGGTGGAAGATTATGCCGAGCTTTTGGCACAAGATGAGGATGGCAATTGA
Transcript >OphauG2|4564
ATGCCAAACCCGTCAAAAAAGCCCCATGGCCCTCGCGCCCCGTCAAATGGAAAAGAAGCCAAGCCCCAAGGCTTC
GCACAGCTCCAATCCAAGATTGAAAAGAGTCTGAGCAACAGCGAGCTGAAAAAGAAGCGCAAGAAGCCTCCCGCC
AGCGCCTCGGAAAAGCCAGAGCCTAAGCGGCAGCGCCCGACTCGCGACGCACCGTCCAAGAGCCTGACAAAAAAG
AGCTCCAAGGCCAACAACCATGCTGATGAGGCGGCGCTGCTGGCGGAAATCAAGGCCTTGGGAGGAGACGAGTCC
GACTTGCATCTCATCAACCATGTCGATTCGGACGACCAGGTTGAGGCACCACATGCGAAGCACAAGGTCGACAAA
CGTCTCAAGGATGAGCTTGCAGCGCTCTCCAACCAGTTGGGCTTTGCCAATGCCAGGCTAGATGACGACAGTAGC
CAAGACGGCCACCTCCAGCAAGGCAGCCAAGACGAGGGCCATGAGCAGCATCAGGACCAGGGTCCTCGGGCGGCA
AAGGCCAACAGCAAAAACATGACCTTTGAGCCTCTAGCAGACTGGCACGCGTCGGGCCTCGCCAGCCTCCCAAAT
CCAGCCTCTGACCAAGCCGCCCCCTTTATGTCCGTCGTGGAGTCGCTCAGGGAGCAAGCCCTCACATATCTGGAA
GAGGACGCGGCCAAGTATAAGACGAGCATCTTTGCCTCGTCGTCACACAAGTTCTTGGCGACAATCATGTCTTCA
GGCACCCTTACAGACAAGGTGTCTGCTCTGACACTGGCCATACAAGAGTCGCCTGTCCACAACACGCGAGCCCTC
GATGCCCTCATGAACCTGGCTTCCAAGAGAAGCCGTGCTCAAGCCATTGGAGCCATTGGAGCTCTAGTCGACCTT
TTCGGCCCAGGGGCGCTTTTGCCCGCAGACCGACGACTACGCACTTTCCAAAGCCAGCCCGGCCTGTTGGGCACC
CTGCAAAAGCACTCGGTAAAGACATGGGCTCCTCACCAGCCTCTCCCTGGCAGCTTGACCAAGGCTCACCTCATT
GCCTGGGTCTACGAAGACTGGCTCAAGGAAACCTACTTCAAGCTCATACAGCTGCTCGAGGTGTGGTGTGCCGAT
GAGATTGAATTTTCTCGCACCAAGGCCCTTGACTTTGTCTACGCCCTGCTCAAAGACAAGCCCGAGCAAGAGGCC
AATTTGCTCACTCTTCTCGTCAACAAGCTAGGCGATAGAGATGGAAAGATTTCTTCCCGAGCCTCGTACCTTCTC
CTGCAGCTGCAGGTGTCTCATCCCGGCATGAAGCCCATCATTATCCGTGCCATTGAGCAGGGCATTCTTGTCCAT
CCATCACTGGACACGCGGCCAAAGTACTACGCAATCAATACTTTGAACCAGACAATTCTCAGCAGCAAGGAACCA
GGCGTAGCCGAATCCCTCATTCGTATATATTTCCACCTTTTTGTAACCCTGCTAAAGGGGGGGAGCCTTGGCTTT
TCGCTCGACCAAGCATCTGGCCATGCAAAAGAGTCGTCCAAGAAACAGGACAGGCAAGACAAGAGAGCCAAGCAA
CCGCCGGCAAAGGGGAAATATGGCAAGCCCCCAGCCGCCAAGCCCCTGGCGCCAGAGACAGAGTCGGCCGACAAG
CTCGTTTCTGCAATCCTTACTGGAGTTAATCGAGCAGCGCCATTCGTGGGCGCCAATGATGCCATCTTGGAAACA
CACCTCGACACGCTCTTCAAGATTGCCCACTCGGCCAACCTCAACACTGGTATTCAGGCCCTGCTCTTGATTCAA
CACCTCTCATCGGCAAGAAATCTAGCAACAGACCGATTCTACCGCACGCTGTACGAGTCGTTGTTGGACCCGCGG
CTCGTGACGTCGTCGAAGCAGGCACTCTATCTCAACCTGCTGCTTCGAGCCCTCAAGAGCGACATTGATGTGCGG
AGGGTCAAGGCTTTCGTCAAGAGGATGCTACAGATATCCAACCTGCACCAGCCGTCATTTGTGTGTGGTTTGCTC
TACATTGTCTCCCAACTGTGGCAGACATTTCCCGACCTGGCAACCTTGGTGGAAGAGCCAGAAGCGTCTGCCTTT
GACGATGATGAGGCCTTGAATCAAGACGGGCGGTACGATGGGCGCAAACGCGATCCTGAGCACTGCAATGCACAG
GGCAGTTGTCTGTGGGAGCTGATTCCAGTCATGGCGCATTTTCACCCTTCAGTCAGTGTCTATGCCACAGCGCTA
CTGGACAAGGAGCGCAAACTGCATAAGCCGGACCTGGAGAGCCATACGCTCATCAGATTTCTCGACAAGTTTGTG
TACAAGAACCCCAAGACGGCCGACACTAGTCGCGGCACGTCAATCATGCAGCCTCTGCGGGCGGCCAAGGACGGG
GGCAACACATGGCTGGGCAGCAGAAGCGCAGGCAGTTCGGCAACCTTTGTCAACTCGGCGGCCTTTTGGAGCAAA
AAGGCAGACGAGGTTGCTGCTCAAGACGTCTTTTTCCACCAATACTTTCAGCACTTGCCCGGGGGGCCAGCCAAG
AAGCAGAAGAAGAAACAGCCCGGTGAGACGAGTGCACACGACAGCGACAAGGGCGGCGGCGATGACGACGACGAC
GACGACGACGACGAGATTTGGAAGGCACTTGTGTCGACGCGGCCAGAGATTACAGGCGACGGGTCGGTAGATGGG
TTTGACGATTTGGACGAGCTGGACATGGCGTCAGAGGATGATGGCTCGTCGCCAGCCCTGTCCTTGGACAGCGAC
ATGGACAGCGATGACCAAGATGATTTTGCATCGGATCAAGCGGCAGACGATGGCTTGGTGGCGGTTGCAGAGGCC
GACCAAGACGAGGCAGACGAGGGGAAAAGCAAGAAGAAGTCGAGGAGGCGGGCGCTCAAGGCCCTGCCCATGTTT
GCGTCGGTGGAAGATTATGCCGAGCTTTTGGCACAAGATGAGGATGGCAATTGA
Gene >OphauG2|4564
ATGCCAAACCCGTCAAAAAAGCCCCATGGCCCTCGCGCCCCGTCAAATGGAAAAGAAGCCAAGCCCCAAGGCTTC
GCACAGCTCCAATCCAAGATTGAAAAGAGTCTGAGCAACAGCGAGCTGAAAAAGAAGCGCAAGAAGCCTCCCGCC
AGCGCCTCGGAAAAGCCAGAGCCTAAGCGGCAGCGCCCGACTCGCGACGCACCGTCCAAGAGCCTGACAAAAAAG
AGCTCCAAGGCCAACAACCATGCTGATGAGGCGGCGCTGCTGGCGGAAATCAAGGCCTTGGGAGGAGACGAGTCC
GACTTGCATCTCATCAACCATGTCGATTCGGACGACCAGGTTGAGGCACCACATGCGAAGCACAAGGTCGACAAA
CGTCTCAAGGATGAGCTTGCAGCGCTCTCCAACCAGTTGGGCTTTGCCAATGCCAGGCTAGATGACGACAGTAGC
CAAGACGGCCACCTCCAGCAAGGCAGCCAAGACGAGGGCCATGAGCAGCATCAGGACCAGGGTCCTCGGGCGGCA
AAGGCCAACAGCAAAAACATGGTGAGTGCGTCTTGTCCCCCTCCAATTTGCTCGTCGTCGCTCAGACAGACTTGT
CGGACAATACCAGACCTTTGAGCCTCTAGCAGACTGGCACGCGTCGGGCCTCGCCAGCCTCCCAAATCCAGCCTC
TGACCAAGCCGCCCCCTTTATGTCCGTCGTGGAGTCGCTCAGGGAGCAAGCCCTCACATATCTGGAAGAGGACGC
GGCCAAGTATAAGACGAGCATCTTTGCCTCGTCGTCACACAAGTTCTTGGCGACAATCATGTCTTCAGGCACCCT
TACAGACAAGGTGTCTGCTCTGACACTGGCCATACAAGAGTCGCCTGTCCACAACACGCGAGCCCTCGATGCCCT
CATGAACCTGGCTTCCAAGAGAAGCCGTGCTCAAGCCATTGGAGCCATTGGAGCTCTAGTCGACCTTTTCGGCCC
AGGGGCGCTTTTGCCCGCAGACCGACGACTACGCACTTTCCAAAGCCAGCCCGGCCTGTTGGGCACCCTGCAAAA
GCACTCGGTAAAGACATGGGCTCCTCACCAGCCTCTCCCTGGCAGCTTGACCAAGGCTCACCTCATTGCCTGGGT
CTACGAAGACTGGCTCAAGGAAACCTACTTCAAGCTCATACAGCTGCTCGAGGTGTGGTGTGCCGATGAGATTGA
ATTTTCTCGCACCAAGGCCCTTGACTTTGTCTACGCCCTGCTCAAAGACAAGCCCGAGCAAGAGGCCAATTTGCT
CACTCTTCTCGTCAACAAGCTAGGCGATAGAGATGGAAAGATTTCTTCCCGAGCCTCGTACCTTCTCCTGCAGCT
GCAGGTGTCTCATCCCGGCATGAAGCCCATCATTATCCGTGCCATTGAGCAGGGCATTCTTGTCCATCCATCACT
GGACACGCGGCCAAAGTACTACGCAATCAATACTTTGAACCAGACAATTCTCAGCAGCAAGGAACCAGGCGTAGC
CGAATCCCTCATTCGTATATATTTCCACCTTTTTGTAACCCTGCTAAAGGGGGGGAGCCTTGGCTTTTCGCTCGA
CCAAGCATCTGGCCATGCAAAAGAGTCGTCCAAGAAACAGGACAGGCAAGACAAGAGAGCCAAGCAACCGCCGGC
AAAGGGGAAATATGGCAAGCCCCCAGCCGCCAAGCCCCTGGCGCCAGAGACAGAGTCGGCCGACAAGCTCGTTTC
TGCAATCCTTACTGGAGTTAATCGAGCAGCGCCATTCGTGGGCGCCAATGATGCCATGTGAGTAAAGACGCGCCA
TGCTGGATTTGCAACAACATTTCCCCCTCCCTTGCTCACTACTGCACGCATAGCTTGGAAACACACCTCGACACG
CTCTTCAAGATTGCCCACTCGGCCAACCTCAACACTGGTATTCAGGCCCTGCTCTTGATTCAACACCTCTCATCG
GCAAGAAATCTAGCAACAGACCGATTCTACCGCACGCTGTACGAGTCGTTGTTGGACCCGCGGCTCGTGACGTCG
TCGAAGCAGGCACTCTATCTCAACCTGCTGCTTCGAGCCCTCAAGAGCGACATTGATGTGCGGAGGGTCAAGGCT
TTCGTCAAGAGGATGCTACAGATATCCAACCTGCACCAGCCGTCATTTGTGTGTGGTTTGCTCTACATTGTCTCC
CAACTGTGGCAGACATTTCCCGACCTGGCAACCTTGGTGGAAGAGCCAGAAGCGTCTGCCTTTGACGATGATGAG
GCCTTGAATCAAGACGGGCGGTACGATGGGCGCAAACGCGATCCTGAGCACTGCAATGCACAGGGCAGTTGTCTG
TGGGAGCTGGTAAGCCCTGGAGCCGCAATATGGCCCTCTTATCTATGCACAGGCAATCCGTCTTGTTGCTTACCA
CATTTGATGCAGATTCCAGTCATGGCGCATTTTCACCCTTCAGTCAGTGTCTATGCCACAGCGCTACTGGACAAG
GAGCGCAAACTGCATAAGCCGGACCTGGAGAGCCATACGCTCATCAGATTTCTCGACAAGTTTGTGTACAAGAAC
CCCAAGACGGCCGACACTAGTCGCGGCACGTCAATCATGCAGCCTCTGCGGGCGGCCAAGGACGGGGGCAACACA
TGGCTGGGCAGCAGAAGCGCAGGCAGTTCGGCAACCTTTGTCAACTCGGCGGCCTTTTGGAGCAAAAAGGCAGAC
GAGGTTGCTGCTCAAGACGTCTTTTTCCACCAATACTTTCAGCACTTGCCCGGGGGGCCAGCCAAGAAGCAGAAG
AAGAAACAGCCCGGTGAGACGAGTGCACACGACAGCGACAAGGGCGGCGGCGATGACGACGACGACGACGACGAC
GACGAGATTTGGAAGGCACTTGTGTCGACGCGGCCAGAGATTACAGGCGACGGGTCGGTAGATGGGTTTGACGAT
TTGGACGAGCTGGACATGGCGTCAGAGGATGATGGCTCGTCGCCAGCCCTGTCCTTGGACAGCGACATGGACAGC
GATGACCAAGATGATTTTGCATCGGATCAAGCGGCAGACGATGGCTTGGTGGCGGTTGCAGAGGCCGACCAAGAC
GAGGCAGACGAGGGGAAAAGCAAGAAGAAGTCGAGGAGGCGGGCGCTCAAGGCCCTGCCCATGTTTGCGTCGGTG
GAAGATTATGCCGAGCTTTTGGCACAAGATGAGGATGGCAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail