Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4563
Gene name
LocationContig_389:3047..4701
Strand-
Gene length (bp)1654
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) 1.3E-32 86 329
PF03129 HGTP_anticodon Anticodon binding domain 8.0E-10 348 404

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74765|SYPM_SCHPO Probable proline--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC24C6.03 PE=3 SV=1 12 420 6.0E-107
sp|F8DT95|SYP_ZYMMA Proline--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=proS PE=3 SV=1 15 428 2.0E-82
sp|P0DJA8|SYP_ZYMMO Proline--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=proS PE=3 SV=1 15 428 3.0E-82
sp|Q7L3T8|SYPM_HUMAN Probable proline--tRNA ligase, mitochondrial OS=Homo sapiens GN=PARS2 PE=1 SV=1 18 420 9.0E-82
sp|Q8UFV9|SYP_AGRFC Proline--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=proS PE=3 SV=2 15 429 1.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74765|SYPM_SCHPO Probable proline--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC24C6.03 PE=3 SV=1 12 420 6.0E-107
sp|F8DT95|SYP_ZYMMA Proline--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=proS PE=3 SV=1 15 428 2.0E-82
sp|P0DJA8|SYP_ZYMMO Proline--tRNA ligase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=proS PE=3 SV=1 15 428 3.0E-82
sp|Q7L3T8|SYPM_HUMAN Probable proline--tRNA ligase, mitochondrial OS=Homo sapiens GN=PARS2 PE=1 SV=1 18 420 9.0E-82
sp|Q8UFV9|SYP_AGRFC Proline--tRNA ligase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=proS PE=3 SV=2 15 429 1.0E-81
sp|Q30S93|SYP_SULDN Proline--tRNA ligase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=proS PE=3 SV=1 1 404 3.0E-80
sp|Q135Z6|SYP_RHOPS Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB5) GN=proS PE=3 SV=1 15 426 7.0E-80
sp|Q89KM8|SYP_BRADU Proline--tRNA ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=proS PE=3 SV=1 15 435 3.0E-78
sp|Q5PAZ5|SYP_ANAMM Proline--tRNA ligase OS=Anaplasma marginale (strain St. Maries) GN=proS PE=3 SV=1 15 432 3.0E-78
sp|B6JH58|SYP_OLICO Proline--tRNA ligase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=proS PE=3 SV=1 15 436 4.0E-78
sp|Q1QLA8|SYP_NITHX Proline--tRNA ligase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=proS PE=3 SV=1 15 426 5.0E-78
sp|Q2K9R4|SYP_RHIEC Proline--tRNA ligase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=proS PE=3 SV=2 15 429 5.0E-77
sp|B3PW17|SYP_RHIE6 Proline--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=proS PE=3 SV=1 15 429 8.0E-77
sp|Q3SRG6|SYP_NITWN Proline--tRNA ligase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=proS PE=3 SV=1 15 426 1.0E-76
sp|B0ULM2|SYP_METS4 Proline--tRNA ligase OS=Methylobacterium sp. (strain 4-46) GN=proS PE=3 SV=1 15 432 2.0E-76
sp|Q1MIJ6|SYP_RHIL3 Proline--tRNA ligase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=proS PE=3 SV=1 15 429 2.0E-76
sp|B1ZA28|SYP_METPB Proline--tRNA ligase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=proS PE=3 SV=1 15 437 3.0E-76
sp|B8IUW4|SYP_METNO Proline--tRNA ligase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=proS PE=3 SV=1 15 430 3.0E-76
sp|B1LUL8|SYP_METRJ Proline--tRNA ligase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=proS PE=3 SV=1 1 437 6.0E-76
sp|Q2IWW0|SYP_RHOP2 Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain HaA2) GN=proS PE=3 SV=1 15 426 7.0E-76
sp|C0R3N5|SYP_WOLWR Proline--tRNA ligase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=proS PE=3 SV=1 15 436 7.0E-76
sp|Q2GK70|SYP_ANAPZ Proline--tRNA ligase OS=Anaplasma phagocytophilum (strain HZ) GN=proS PE=3 SV=1 15 420 8.0E-76
sp|A1USY3|SYP_BARBK Proline--tRNA ligase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=proS PE=3 SV=1 15 429 2.0E-75
sp|B5ZYN2|SYP_RHILW Proline--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=proS PE=3 SV=1 15 429 5.0E-75
sp|Q8CFI5|SYPM_MOUSE Probable proline--tRNA ligase, mitochondrial OS=Mus musculus GN=Pars2 PE=1 SV=2 18 420 6.0E-75
sp|B7KPK1|SYP_METC4 Proline--tRNA ligase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=proS PE=3 SV=1 15 437 7.0E-75
sp|A8I438|SYP_AZOC5 Proline--tRNA ligase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=proS PE=3 SV=1 15 415 7.0E-75
sp|B4RBZ9|SYP_PHEZH Proline--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=proS PE=3 SV=1 1 425 7.0E-75
sp|A7HY28|SYP_PARL1 Proline--tRNA ligase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=proS PE=3 SV=1 15 429 8.0E-75
sp|A9W1L5|SYP_METEP Proline--tRNA ligase OS=Methylobacterium extorquens (strain PA1) GN=proS PE=3 SV=1 15 437 8.0E-75
sp|Q5HBI6|SYP_EHRRW Proline--tRNA ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=proS PE=3 SV=1 15 415 1.0E-74
sp|Q215F8|SYP_RHOPB Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain BisB18) GN=proS PE=3 SV=1 15 425 1.0E-74
sp|B0SZ28|SYP_CAUSK Proline--tRNA ligase OS=Caulobacter sp. (strain K31) GN=proS PE=3 SV=1 15 420 1.0E-74
sp|Q5FHL5|SYP_EHRRG Proline--tRNA ligase OS=Ehrlichia ruminantium (strain Gardel) GN=proS PE=3 SV=1 15 415 2.0E-74
sp|Q5M7W7|SYPM_RAT Probable proline--tRNA ligase, mitochondrial OS=Rattus norvegicus GN=Pars2 PE=2 SV=1 18 420 2.0E-74
sp|Q07NK2|SYP_RHOP5 Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain BisA53) GN=proS PE=3 SV=1 15 426 2.0E-74
sp|A9MAJ9|SYP_BRUC2 Proline--tRNA ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=proS PE=3 SV=1 15 429 3.0E-74
sp|Q8YGL8|SYP_BRUME Proline--tRNA ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=proS PE=3 SV=2 15 429 3.0E-74
sp|C0RIF7|SYP_BRUMB Proline--tRNA ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=proS PE=3 SV=1 15 429 3.0E-74
sp|Q8G197|SYP_BRUSU Proline--tRNA ligase OS=Brucella suis biovar 1 (strain 1330) GN=proS PE=3 SV=1 15 429 4.0E-74
sp|Q4ULX2|SYP_RICFE Proline--tRNA ligase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=proS PE=3 SV=1 15 434 5.0E-74
sp|Q57DT1|SYP_BRUAB Proline--tRNA ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=proS PE=3 SV=1 15 429 6.0E-74
sp|Q2YNE3|SYP_BRUA2 Proline--tRNA ligase OS=Brucella abortus (strain 2308) GN=proS PE=3 SV=1 15 429 6.0E-74
sp|B2S561|SYP_BRUA1 Proline--tRNA ligase OS=Brucella abortus (strain S19) GN=proS PE=3 SV=1 15 429 6.0E-74
sp|Q73GW6|SYP_WOLPM Proline--tRNA ligase OS=Wolbachia pipientis wMel GN=proS PE=3 SV=1 15 436 7.0E-74
sp|B0CLE9|SYP_BRUSI Proline--tRNA ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=proS PE=3 SV=1 15 429 7.0E-74
sp|A7INT8|SYP_XANP2 Proline--tRNA ligase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=proS PE=3 SV=1 15 426 1.0E-73
sp|Q9A6Z5|SYP_CAUCR Proline--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=proS PE=3 SV=1 15 430 1.0E-73
sp|B8GWT1|SYP_CAUCN Proline--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=proS PE=3 SV=1 15 430 1.0E-73
sp|A5VQ02|SYP_BRUO2 Proline--tRNA ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=proS PE=3 SV=1 15 429 1.0E-73
sp|Q6FZX5|SYP_BARQU Proline--tRNA ligase OS=Bartonella quintana (strain Toulouse) GN=proS PE=3 SV=1 15 430 2.0E-73
sp|A5V8U0|SYP_SPHWW Proline--tRNA ligase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=proS PE=3 SV=1 15 420 3.0E-73
sp|Q92QN2|SYP_RHIME Proline--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=proS PE=3 SV=1 15 429 4.0E-73
sp|A5FX26|SYP_ACICJ Proline--tRNA ligase OS=Acidiphilium cryptum (strain JF-5) GN=proS PE=3 SV=1 15 403 4.0E-73
sp|A1B1L0|SYP_PARDP Proline--tRNA ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=proS PE=3 SV=1 15 403 4.0E-73
sp|Q4FM73|SYP_PELUB Proline--tRNA ligase OS=Pelagibacter ubique (strain HTCC1062) GN=proS PE=3 SV=1 15 415 6.0E-73
sp|Q3YSD4|SYP_EHRCJ Proline--tRNA ligase OS=Ehrlichia canis (strain Jake) GN=proS PE=3 SV=1 14 418 1.0E-72
sp|Q6N5P6|SYP_RHOPA Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=proS PE=1 SV=1 15 426 1.0E-72
sp|B3Q7L2|SYP_RHOPT Proline--tRNA ligase OS=Rhodopseudomonas palustris (strain TIE-1) GN=proS PE=3 SV=1 15 426 2.0E-72
sp|A6U7Z3|SYP_SINMW Proline--tRNA ligase OS=Sinorhizobium medicae (strain WSM419) GN=proS PE=3 SV=1 15 429 2.0E-72
sp|Q1RIC9|SYP_RICBR Proline--tRNA ligase OS=Rickettsia bellii (strain RML369-C) GN=proS PE=3 SV=1 15 420 3.0E-72
sp|A8GU77|SYP_RICB8 Proline--tRNA ligase OS=Rickettsia bellii (strain OSU 85-389) GN=proS PE=3 SV=1 15 420 3.0E-72
sp|A6X1L5|SYP_OCHA4 Proline--tRNA ligase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=proS PE=3 SV=1 15 429 3.0E-72
sp|Q5GTK5|SYP_WOLTR Proline--tRNA ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=proS PE=3 SV=1 15 433 5.0E-72
sp|A5EK68|SYP_BRASB Proline--tRNA ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=proS PE=3 SV=1 15 435 8.0E-72
sp|Q1GFI1|SYP_RUEST Proline--tRNA ligase OS=Ruegeria sp. (strain TM1040) GN=proS PE=3 SV=1 15 428 9.0E-72
sp|Q28TI5|SYP_JANSC Proline--tRNA ligase OS=Jannaschia sp. (strain CCS1) GN=proS PE=3 SV=1 15 440 1.0E-71
sp|Q6G3A4|SYP_BARHE Proline--tRNA ligase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=proS PE=3 SV=1 15 430 1.0E-71
sp|A4YVI0|SYP_BRASO Proline--tRNA ligase OS=Bradyrhizobium sp. (strain ORS278) GN=proS PE=3 SV=1 15 435 2.0E-71
sp|B2IDI9|SYP_BEII9 Proline--tRNA ligase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=proS PE=3 SV=1 15 430 3.0E-71
sp|B9KLX3|SYP_RHOSK Proline--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=proS PE=3 SV=1 15 429 4.0E-71
sp|A3PMH0|SYP_RHOS1 Proline--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=proS PE=3 SV=1 15 429 4.0E-71
sp|A9IUL1|SYP_BART1 Proline--tRNA ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=proS PE=3 SV=1 15 403 5.0E-71
sp|Q3IZS9|SYP_RHOS4 Proline--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=proS PE=3 SV=1 15 429 7.0E-71
sp|Q9ZDE7|SYP_RICPR Proline--tRNA ligase OS=Rickettsia prowazekii (strain Madrid E) GN=proS PE=3 SV=1 15 439 1.0E-70
sp|A8EZ51|SYP_RICCK Proline--tRNA ligase OS=Rickettsia canadensis (strain McKiel) GN=proS PE=3 SV=1 15 434 3.0E-70
sp|Q92I92|SYP_RICCN Proline--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=proS PE=3 SV=1 15 430 3.0E-70
sp|C3PNA1|SYP_RICAE Proline--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=proS PE=3 SV=1 15 430 3.0E-70
sp|A4WPJ3|SYP_RHOS5 Proline--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=proS PE=3 SV=1 15 403 4.0E-70
sp|A8LQU6|SYP_DINSH Proline--tRNA ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=proS PE=3 SV=1 15 439 1.0E-69
sp|Q2RU19|SYP_RHORT Proline--tRNA ligase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=proS PE=3 SV=1 1 420 1.0E-69
sp|Q11JI8|SYP_CHESB Proline--tRNA ligase OS=Chelativorans sp. (strain BNC1) GN=proS PE=3 SV=1 15 435 1.0E-69
sp|Q0C1C5|SYP_HYPNA Proline--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=proS PE=3 SV=1 15 432 2.0E-69
sp|A8GRW1|SYP_RICRS Proline--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=proS PE=3 SV=1 15 430 2.0E-69
sp|B0BXB9|SYP_RICRO Proline--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=proS PE=3 SV=1 15 430 2.0E-69
sp|Q5LUD3|SYP_RUEPO Proline--tRNA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=proS PE=3 SV=1 15 420 4.0E-69
sp|Q68WZ3|SYP_RICTY Proline--tRNA ligase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=proS PE=3 SV=1 15 434 4.0E-69
sp|A8GN90|SYP_RICAH Proline--tRNA ligase OS=Rickettsia akari (strain Hartford) GN=proS PE=3 SV=1 15 434 5.0E-69
sp|Q5FUU9|SYP_GLUOX Proline--tRNA ligase OS=Gluconobacter oxydans (strain 621H) GN=proS PE=3 SV=1 15 420 6.0E-69
sp|C4K2D7|SYP_RICPU Proline--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=proS PE=3 SV=1 15 403 1.0E-68
sp|Q0APX0|SYP_MARMM Proline--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=proS PE=3 SV=1 15 428 5.0E-68
sp|Q168E6|SYP_ROSDO Proline--tRNA ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=proS PE=3 SV=1 15 420 5.0E-68
sp|B8EP84|SYP_METSB Proline--tRNA ligase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=proS PE=3 SV=1 15 420 3.0E-67
sp|Q98KS5|SYP_RHILO Proline--tRNA ligase OS=Rhizobium loti (strain MAFF303099) GN=proS PE=3 SV=1 15 425 7.0E-67
sp|Q2GG92|SYP_EHRCR Proline--tRNA ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=proS PE=3 SV=1 14 415 9.0E-66
sp|Q0BSM0|SYP_GRABC Proline--tRNA ligase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=proS PE=3 SV=2 15 403 3.0E-65
sp|Q2GE40|SYP_NEOSM Proline--tRNA ligase OS=Neorickettsia sennetsu (strain Miyayama) GN=proS PE=3 SV=1 15 404 9.0E-63
sp|C0QTI8|SYP_PERMH Proline--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=proS PE=3 SV=1 1 228 3.0E-57
sp|B2V6W5|SYP_SULSY Proline--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=proS PE=3 SV=1 15 228 1.0E-56
sp|Q2RJN1|SYP_MOOTA Proline--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=proS PE=3 SV=1 15 232 2.0E-55
sp|A4XHN7|SYP_CALS8 Proline--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=proS PE=3 SV=1 1 228 5.0E-54
sp|Q0AYJ4|SYP_SYNWW Proline--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=proS PE=3 SV=1 1 234 7.0E-54
sp|B9MPD7|SYP_CALBD Proline--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=proS PE=3 SV=1 1 228 5.0E-53
sp|B4U8B2|SYP_HYDS0 Proline--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=proS PE=3 SV=1 14 226 5.0E-53
sp|P39965|SYPM_YEAST Probable proline--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM10 PE=1 SV=1 21 245 1.0E-52
sp|O66690|SYP_AQUAE Proline--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=proS PE=1 SV=1 15 226 3.0E-52
sp|B1HQZ9|SYP_LYSSC Proline--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=proS PE=3 SV=1 15 235 6.0E-52
sp|Q890M2|SYP_CLOTE Proline--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=proS PE=3 SV=1 15 259 1.0E-51
sp|B5EKH7|SYP_ACIF5 Proline--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=proS PE=3 SV=1 1 230 2.0E-51
sp|B7J4Y9|SYP_ACIF2 Proline--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=proS PE=3 SV=1 1 230 2.0E-51
sp|B9LZK1|SYP_GEODF Proline--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=proS PE=3 SV=1 1 230 4.0E-51
sp|A9BGA8|SYP_PETMO Proline--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=proS PE=3 SV=1 18 240 4.0E-51
sp|Q39VY6|SYP_GEOMG Proline--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=proS PE=3 SV=1 1 230 5.0E-51
sp|Q9WYY4|SYP_THEMA Proline--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=proS PE=3 SV=1 15 241 5.0E-51
sp|A8FDC1|SYP_BACP2 Proline--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=proS PE=3 SV=1 15 245 5.0E-51
sp|Q1MRD0|SYP_LAWIP Proline--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=proS PE=3 SV=1 15 234 6.0E-51
sp|A5IJQ9|SYP_THEP1 Proline--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=proS PE=3 SV=1 15 241 7.0E-51
sp|Q5L0J4|SYP_GEOKA Proline--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=proS PE=3 SV=1 15 238 9.0E-51
sp|A6TL31|SYP_ALKMQ Proline--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=proS PE=3 SV=1 1 239 2.0E-50
sp|A9AI56|SYP_BURM1 Proline--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=proS PE=3 SV=1 15 230 2.0E-50
sp|C5D9C3|SYP_GEOSW Proline--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=proS PE=3 SV=1 15 228 3.0E-50
sp|Q73KJ8|SYP_TREDE Proline--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=proS PE=3 SV=1 13 240 3.0E-50
sp|C4LBX6|SYP_TOLAT Proline--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=proS PE=3 SV=1 15 232 3.0E-50
sp|Q3AB89|SYP_CARHZ Proline--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=proS PE=3 SV=1 1 228 3.0E-50
sp|B0SM58|SYP_LEPBP Proline--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=proS PE=3 SV=1 15 245 3.0E-50
sp|B0SDM9|SYP_LEPBA Proline--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=proS PE=3 SV=1 15 245 3.0E-50
sp|B8IZD1|SYP_DESDA Proline--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=proS PE=3 SV=1 15 231 3.0E-50
sp|Q97ED5|SYP_CLOAB Proline--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=proS PE=3 SV=1 13 238 4.0E-50
sp|Q9KYR6|SYP_STRCO Proline--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=proS PE=3 SV=1 15 226 4.0E-50
sp|Q6AP31|SYP_DESPS Proline--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=proS PE=3 SV=1 1 228 5.0E-50
sp|B8CW65|SYP_HALOH Proline--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=proS PE=3 SV=1 1 230 5.0E-50
sp|B4RV73|SYP_ALTMD Proline--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=proS PE=3 SV=1 15 251 7.0E-50
sp|B1YSV1|SYP_BURA4 Proline--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=proS PE=3 SV=1 15 230 7.0E-50
sp|Q72CD8|SYP_DESVH Proline--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=proS PE=3 SV=1 1 228 7.0E-50
sp|A4IMD1|SYP_GEOTN Proline--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=proS PE=3 SV=1 15 228 7.0E-50
sp|B1L8Y1|SYP_THESQ Proline--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=proS PE=3 SV=1 15 241 7.0E-50
sp|A4SJ23|SYP_AERS4 Proline--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=proS PE=3 SV=1 15 232 9.0E-50
sp|B4E5W6|SYP_BURCJ Proline--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=proS PE=3 SV=1 15 230 1.0E-49
sp|A0KPA5|SYP_AERHH Proline--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=proS PE=3 SV=1 15 232 1.0E-49
sp|B4SV24|SYP_SALNS Proline--tRNA ligase OS=Salmonella newport (strain SL254) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|B5F8V6|SYP_SALA4 Proline--tRNA ligase OS=Salmonella agona (strain SL483) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|Q1BZD6|SYP_BURCA Proline--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=proS PE=3 SV=1 15 230 1.0E-49
sp|A9MPG5|SYP_SALAR Proline--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|A0K4B4|SYP_BURCH Proline--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=proS PE=3 SV=1 15 230 1.0E-49
sp|B1JVA5|SYP_BURCC Proline--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=proS PE=3 SV=1 15 230 1.0E-49
sp|Q7CR62|SYP_SALTY Proline--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|Q8XEY9|SYP_SALTI Proline--tRNA ligase OS=Salmonella typhi GN=proS PE=3 SV=1 15 234 1.0E-49
sp|B5BAQ2|SYP_SALPK Proline--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|A9N0U7|SYP_SALPB Proline--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|Q5PD80|SYP_SALPA Proline--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|B4TK70|SYP_SALHS Proline--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|B5R5J8|SYP_SALG2 Proline--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|B5R434|SYP_SALEP Proline--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|B5FJ42|SYP_SALDC Proline--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=proS PE=3 SV=1 15 234 1.0E-49
sp|Q0BIH4|SYP_BURCM Proline--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=proS PE=3 SV=1 15 230 2.0E-49
sp|B4TYF5|SYP_SALSV Proline--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=proS PE=3 SV=1 15 234 2.0E-49
sp|Q819Y4|SYP1_BACCR Proline--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=proS1 PE=3 SV=1 15 245 2.0E-49
sp|B9KBD7|SYP_THENN Proline--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=proS PE=3 SV=1 15 228 2.0E-49
sp|B9IVA8|SYP_BACCQ Proline--tRNA ligase OS=Bacillus cereus (strain Q1) GN=proS PE=3 SV=1 15 245 2.0E-49
sp|B7HLF2|SYP_BACC7 Proline--tRNA ligase OS=Bacillus cereus (strain AH187) GN=proS PE=3 SV=1 15 245 2.0E-49
sp|Q732Q0|SYP1_BACC1 Proline--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=proS1 PE=3 SV=1 15 245 2.0E-49
sp|A4JBC2|SYP_BURVG Proline--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=proS PE=3 SV=1 15 230 2.0E-49
sp|Q57T14|SYP_SALCH Proline--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=proS PE=3 SV=2 15 234 2.0E-49
sp|B7HDU2|SYP_BACC4 Proline--tRNA ligase OS=Bacillus cereus (strain B4264) GN=proS PE=3 SV=1 15 245 2.0E-49
sp|C0Q6L7|SYP_SALPC Proline--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=proS PE=3 SV=1 15 234 2.0E-49
sp|Q6HEZ6|SYP1_BACHK Proline--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=proS1 PE=3 SV=1 15 240 2.0E-49
sp|Q636K7|SYP1_BACCZ Proline--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=proS1 PE=3 SV=1 15 240 2.0E-49
sp|A5UDZ4|SYP_HAEIE Proline--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=proS PE=3 SV=1 15 232 2.0E-49
sp|C1EP43|SYP_BACC3 Proline--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=proS PE=3 SV=1 15 240 2.0E-49
sp|B7JJ97|SYP_BACC0 Proline--tRNA ligase OS=Bacillus cereus (strain AH820) GN=proS PE=3 SV=1 15 240 2.0E-49
sp|C3L7A8|SYP_BACAC Proline--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=proS PE=3 SV=1 15 240 2.0E-49
sp|C3P5M1|SYP_BACAA Proline--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=proS PE=3 SV=1 15 240 2.0E-49
sp|Q81WL6|SYP1_BACAN Proline--tRNA ligase 1 OS=Bacillus anthracis GN=proS1 PE=3 SV=1 15 240 2.0E-49
sp|A0RHJ2|SYP1_BACAH Proline--tRNA ligase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=proS1 PE=3 SV=1 15 240 2.0E-49
sp|B2GKS1|SYP_KOCRD Proline--tRNA ligase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=proS PE=3 SV=1 13 237 3.0E-49
sp|A1VE74|SYP_DESVV Proline--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=proS PE=3 SV=1 1 228 3.0E-49
sp|Q39JU3|SYP_BURL3 Proline--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=proS PE=3 SV=1 15 230 3.0E-49
sp|A9VT57|SYP_BACWK Proline--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=proS PE=3 SV=1 15 245 3.0E-49
sp|A7GRE9|SYP_BACCN Proline--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=proS PE=3 SV=1 15 245 3.0E-49
sp|Q8F148|SYP_LEPIN Proline--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=proS PE=3 SV=1 15 245 3.0E-49
sp|B7IUH7|SYP_BACC2 Proline--tRNA ligase OS=Bacillus cereus (strain G9842) GN=proS PE=3 SV=1 15 240 4.0E-49
sp|A0L8I2|SYP_MAGMM Proline--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=proS PE=3 SV=1 15 232 4.0E-49
sp|Q5YSB9|SYP_NOCFA Proline--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=proS PE=3 SV=1 15 234 4.0E-49
sp|C5B780|SYP_EDWI9 Proline--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=proS PE=3 SV=1 15 236 4.0E-49
sp|Q13U19|SYP_BURXL Proline--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=proS PE=3 SV=1 15 245 4.0E-49
sp|C6E496|SYP_GEOSM Proline--tRNA ligase OS=Geobacter sp. (strain M21) GN=proS PE=3 SV=1 15 228 4.0E-49
sp|Q72U06|SYP_LEPIC Proline--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=proS PE=3 SV=1 15 245 5.0E-49
sp|A3QG64|SYP_SHELP Proline--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=proS PE=3 SV=1 15 230 5.0E-49
sp|Q7M8L1|SYP_WOLSU Proline--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=proS PE=3 SV=1 15 234 5.0E-49
sp|Q1I6D7|SYP_PSEE4 Proline--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=proS PE=3 SV=1 15 234 6.0E-49
sp|A6VKR5|SYP_ACTSZ Proline--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=proS PE=3 SV=1 15 232 9.0E-49
sp|C6BYX7|SYP_DESAD Proline--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=proS PE=3 SV=1 15 232 9.0E-49
sp|A5UHN3|SYP_HAEIG Proline--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=proS PE=3 SV=1 15 232 1.0E-48
sp|B2TIF5|SYP_CLOBB Proline--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=proS PE=3 SV=1 13 230 1.0E-48
sp|A3DJL6|SYP_CLOTH Proline--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=proS PE=3 SV=1 15 240 1.0E-48
sp|A7Z4S8|SYP_BACMF Proline--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=proS PE=3 SV=1 15 228 1.0E-48
sp|A6T4Z7|SYP_KLEP7 Proline--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=proS PE=3 SV=1 15 235 2.0E-48
sp|A8AL94|SYP_CITK8 Proline--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=proS PE=3 SV=1 15 232 2.0E-48
sp|Q2SZF6|SYP_BURTA Proline--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=proS PE=3 SV=1 15 230 2.0E-48
sp|B2UY89|SYP_CLOBA Proline--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=proS PE=3 SV=1 13 230 2.0E-48
sp|P43830|SYP_HAEIN Proline--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proS PE=1 SV=1 15 232 2.0E-48
sp|Q9I502|SYP_PSEAE Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proS PE=3 SV=1 15 234 2.0E-48
sp|B7UXX6|SYP_PSEA8 Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=proS PE=3 SV=1 15 234 2.0E-48
sp|Q07ZH1|SYP_SHEFN Proline--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=proS PE=3 SV=1 15 228 2.0E-48
sp|Q02IB8|SYP_PSEAB Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=proS PE=3 SV=1 15 234 2.0E-48
sp|A6VA16|SYP_PSEA7 Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=proS PE=3 SV=1 15 234 2.0E-48
sp|B7LW79|SYP_ESCF3 Proline--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|A1SLL4|SYP_NOCSJ Proline--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=proS PE=3 SV=1 15 226 3.0E-48
sp|A1WUX1|SYP_HALHL Proline--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|A3NDS2|SYP_BURP6 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|Q4QMG5|SYP_HAEI8 Proline--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=proS PE=3 SV=1 15 232 3.0E-48
sp|Q63QM5|SYP_BURPS Proline--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|Q3JNG4|SYP_BURP1 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|A3NZI6|SYP_BURP0 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|A1V0N6|SYP_BURMS Proline--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|A2S5R3|SYP_BURM9 Proline--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|A3MR95|SYP_BURM7 Proline--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=proS PE=3 SV=1 15 230 3.0E-48
sp|Q1RFZ4|SYP_ECOUT Proline--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=proS PE=3 SV=2 15 235 3.0E-48
sp|B1LGZ7|SYP_ECOSM Proline--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|Q8FKZ4|SYP_ECOL6 Proline--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proS PE=3 SV=2 15 235 3.0E-48
sp|Q0TLD7|SYP_ECOL5 Proline--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|A1A7N8|SYP_ECOK1 Proline--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=proS PE=3 SV=1 15 235 3.0E-48
sp|B7MP55|SYP_ECO81 Proline--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|B7MBH6|SYP_ECO45 Proline--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|B7UJ96|SYP_ECO27 Proline--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=proS PE=3 SV=1 15 235 3.0E-48
sp|A5VZT5|SYP_PSEP1 Proline--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=proS PE=3 SV=1 15 234 3.0E-48
sp|Q3A6R6|SYP_PELCD Proline--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=proS PE=3 SV=1 15 231 3.0E-48
sp|B1I2J1|SYP_DESAP Proline--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=proS PE=3 SV=1 15 234 3.0E-48
sp|Q88NK2|SYP_PSEPK Proline--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=proS PE=3 SV=1 15 234 3.0E-48
sp|B5EIT9|SYP_GEOBB Proline--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=proS PE=3 SV=1 15 228 3.0E-48
sp|B1JD82|SYP_PSEPW Proline--tRNA ligase OS=Pseudomonas putida (strain W619) GN=proS PE=3 SV=1 15 234 4.0E-48
sp|B1KNR3|SYP_SHEWM Proline--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=proS PE=3 SV=1 15 241 4.0E-48
sp|B7N862|SYP_ECOLU Proline--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=proS PE=3 SV=1 15 235 4.0E-48
sp|B2JHD3|SYP_BURP8 Proline--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=proS PE=3 SV=1 15 230 5.0E-48
sp|B8DNM5|SYP_DESVM Proline--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=proS PE=3 SV=1 1 231 5.0E-48
sp|Q32JR3|SYP_SHIDS Proline--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B5Z0H4|SYP_ECO5E Proline--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|Q8X8W2|SYP_ECO57 Proline--tRNA ligase OS=Escherichia coli O157:H7 GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B7LHA4|SYP_ECO55 Proline--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|Q6D1B9|SYP_PECAS Proline--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=proS PE=3 SV=1 15 236 5.0E-48
sp|P16659|SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) GN=proS PE=1 SV=4 15 235 5.0E-48
sp|B1XD64|SYP_ECODH Proline--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|C4ZRT7|SYP_ECOBW Proline--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|Q3Z5G3|SYP_SHISS Proline--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|Q83MC8|SYP_SHIFL Proline--tRNA ligase OS=Shigella flexneri GN=proS PE=3 SV=4 15 235 5.0E-48
sp|Q0T815|SYP_SHIF8 Proline--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=proS PE=3 SV=2 15 235 5.0E-48
sp|Q325U6|SYP_SHIBS Proline--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B2U338|SYP_SHIB3 Proline--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B6HZR3|SYP_ECOSE Proline--tRNA ligase OS=Escherichia coli (strain SE11) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B1IQE6|SYP_ECOLC Proline--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|A7ZWE2|SYP_ECOHS Proline--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B7M1Z9|SYP_ECO8A Proline--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|A7ZHT6|SYP_ECO24 Proline--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|B0KTK4|SYP_PSEPG Proline--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=proS PE=3 SV=1 15 234 5.0E-48
sp|Q12L53|SYP_SHEDO Proline--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=proS PE=3 SV=1 15 235 5.0E-48
sp|A1S4R2|SYP_SHEAM Proline--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=proS PE=3 SV=1 15 230 5.0E-48
sp|A0QVM0|SYP_MYCS2 Proline--tRNA ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=proS PE=1 SV=1 15 239 5.0E-48
sp|A8H6J5|SYP_SHEPA Proline--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=proS PE=3 SV=1 15 230 6.0E-48
sp|A6LPP0|SYP_CLOB8 Proline--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=proS PE=3 SV=1 13 235 6.0E-48
sp|B2SYU8|SYP_BURPP Proline--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=proS PE=3 SV=1 15 230 6.0E-48
sp|B5Y1H7|SYP_KLEP3 Proline--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=proS PE=3 SV=1 15 235 7.0E-48
sp|Q62GV8|SYP_BURMA Proline--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=proS PE=3 SV=1 15 230 7.0E-48
sp|Q87Y24|SYP_PSESM Proline--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=proS PE=3 SV=1 15 235 8.0E-48
sp|B7IFB6|SYP_THEAB Proline--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=proS PE=3 SV=1 18 245 1.0E-47
sp|Q0VRL1|SYP_ALCBS Proline--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=proS PE=3 SV=2 15 232 1.0E-47
sp|B2US70|SYP_HELPS Proline--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=proS PE=3 SV=1 15 228 1.0E-47
sp|A1R508|SYP_ARTAT Proline--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=proS PE=3 SV=1 13 231 1.0E-47
sp|Q8R7S9|SYP_CALS4 Proline--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=proS PE=3 SV=1 1 238 1.0E-47
sp|Q1QDK7|SYP_PSYCK Proline--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=proS PE=3 SV=1 18 235 1.0E-47
sp|Q4ZWM2|SYP_PSEU2 Proline--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=proS PE=3 SV=1 15 235 1.0E-47
sp|P56124|SYP_HELPY Proline--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=proS PE=3 SV=1 15 228 1.0E-47
sp|Q47ID0|SYP_DECAR Proline--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=proS PE=3 SV=1 18 235 1.0E-47
sp|A5D2U6|SYP_PELTS Proline--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=proS PE=3 SV=1 15 238 2.0E-47
sp|Q4FUL6|SYP_PSYA2 Proline--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=proS PE=3 SV=1 18 228 2.0E-47
sp|B0TNJ5|SYP_SHEHH Proline--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=proS PE=3 SV=1 15 230 2.0E-47
sp|A4XRQ7|SYP_PSEMY Proline--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=proS PE=3 SV=1 15 235 2.0E-47
sp|B5ZA05|SYP_HELPG Proline--tRNA ligase OS=Helicobacter pylori (strain G27) GN=proS PE=3 SV=1 15 228 2.0E-47
sp|A6Q3S4|SYP_NITSB Proline--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=proS PE=3 SV=1 15 228 2.0E-47
sp|Q1CUR4|SYP_HELPH Proline--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=proS PE=3 SV=1 15 228 2.0E-47
sp|B6JKG9|SYP_HELP2 Proline--tRNA ligase OS=Helicobacter pylori (strain P12) GN=proS PE=3 SV=1 15 228 2.0E-47
sp|C5BPN9|SYP_TERTT Proline--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=proS PE=3 SV=1 15 242 2.0E-47
sp|Q3ZZD0|SYP_DEHMC Proline--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=proS PE=3 SV=1 15 228 2.0E-47
sp|A7HKV2|SYP_FERNB Proline--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=proS PE=3 SV=1 18 222 2.0E-47
sp|Q8XHQ4|SYP_CLOPE Proline--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=proS PE=3 SV=1 13 233 2.0E-47
sp|Q0TMM3|SYP_CLOP1 Proline--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=proS PE=3 SV=1 13 238 2.0E-47
sp|C1L2M5|SYP_LISMC Proline--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=proS PE=3 SV=1 15 228 2.0E-47
sp|Q0SQC0|SYP_CLOPS Proline--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=proS PE=3 SV=1 13 238 2.0E-47
sp|Q8Y7G2|SYP_LISMO Proline--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=proS PE=3 SV=1 15 228 3.0E-47
sp|Q720A3|SYP_LISMF Proline--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=proS PE=3 SV=1 15 228 3.0E-47
sp|A4J5Y2|SYP_DESRM Proline--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=proS PE=3 SV=1 15 230 3.0E-47
sp|Q15WD6|SYP_PSEA6 Proline--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=proS PE=3 SV=1 15 234 3.0E-47
sp|C1DRG4|SYP_AZOVD Proline--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=proS PE=3 SV=1 15 235 3.0E-47
sp|B8DG08|SYP_LISMH Proline--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=proS PE=3 SV=1 15 228 3.0E-47
sp|A7ZD35|SYP_CAMC1 Proline--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=proS PE=3 SV=1 15 228 3.0E-47
sp|A0AIC0|SYP_LISW6 Proline--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=proS PE=3 SV=1 15 228 3.0E-47
sp|A4SVA7|SYP_POLSQ Proline--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=proS PE=3 SV=1 15 232 3.0E-47
sp|Q74D59|SYP_GEOSL Proline--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=proS PE=3 SV=1 15 230 3.0E-47
sp|A5FS84|SYP_DEHMB Proline--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=proS PE=3 SV=1 15 228 3.0E-47
sp|A7MI22|SYP_CROS8 Proline--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=proS PE=3 SV=1 15 232 3.0E-47
sp|B1YI68|SYP_EXIS2 Proline--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=proS PE=3 SV=1 1 233 4.0E-47
sp|B0K5F2|SYP_THEPX Proline--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=proS PE=3 SV=1 15 235 4.0E-47
sp|B7NKX8|SYP_ECO7I Proline--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=proS PE=3 SV=1 15 235 4.0E-47
sp|Q83GR4|SYP_TROWT Proline--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=proS PE=3 SV=1 8 215 5.0E-47
sp|Q7N8M7|SYP_PHOLL Proline--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=proS PE=3 SV=1 15 232 6.0E-47
sp|C6DDF6|SYP_PECCP Proline--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=proS PE=3 SV=1 15 236 6.0E-47
sp|Q46X21|SYP_CUPPJ Proline--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=proS PE=3 SV=1 15 230 7.0E-47
sp|Q83HI1|SYP_TROW8 Proline--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=proS PE=3 SV=1 8 215 7.0E-47
sp|B0KCH5|SYP_THEP3 Proline--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=proS PE=3 SV=1 15 235 8.0E-47
sp|Q5QW31|SYP_IDILO Proline--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=proS PE=3 SV=1 15 232 8.0E-47
sp|A4VNB4|SYP_PSEU5 Proline--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=proS PE=3 SV=1 15 234 8.0E-47
sp|Q48FB4|SYP_PSE14 Proline--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=proS PE=3 SV=1 15 235 8.0E-47
sp|A6Q7Y7|SYP_SULNB Proline--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=proS PE=3 SV=1 15 251 9.0E-47
sp|A5WDG2|SYP_PSYWF Proline--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=proS PE=3 SV=1 18 230 1.0E-46
sp|B0THP0|SYP_HELMI Proline--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=proS PE=3 SV=1 15 233 1.0E-46
sp|Q0I4S8|SYP_HAES1 Proline--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=proS PE=3 SV=1 15 232 1.0E-46
sp|B0RZJ0|SYP_FINM2 Proline--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=proS PE=3 SV=1 15 233 1.0E-46
sp|B0UWK9|SYP_HISS2 Proline--tRNA ligase OS=Histophilus somni (strain 2336) GN=proS PE=3 SV=1 15 232 1.0E-46
sp|Q3Z9I5|SYP_DEHM1 Proline--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=proS PE=3 SV=1 15 228 1.0E-46
sp|Q9ZMJ6|SYP_HELPJ Proline--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=proS PE=3 SV=1 20 235 1.0E-46
sp|B3R894|SYP_CUPTR Proline--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=proS PE=3 SV=1 15 230 2.0E-46
sp|B2VDZ9|SYP_ERWT9 Proline--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=proS PE=3 SV=1 15 230 2.0E-46
sp|Q65QU0|SYP_MANSM Proline--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=proS PE=3 SV=2 15 244 2.0E-46
sp|Q053M7|SYP_LEPBL Proline--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=proS PE=3 SV=1 15 236 2.0E-46
sp|A1VYQ2|SYP_CAMJJ Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=proS PE=3 SV=1 15 238 2.0E-46
sp|Q0K6Q0|SYP_CUPNH Proline--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=proS PE=3 SV=1 15 230 2.0E-46
sp|Q04U64|SYP_LEPBJ Proline--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=proS PE=3 SV=1 15 236 2.0E-46
sp|Q2LTR7|SYP_SYNAS Proline--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=proS PE=3 SV=2 15 228 2.0E-46
sp|B8GPP4|SYP_THISH Proline--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=proS PE=3 SV=1 15 232 2.0E-46
sp|A7H4J9|SYP_CAMJD Proline--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=proS PE=3 SV=1 15 238 2.0E-46
sp|Q5HVM3|SYP_CAMJR Proline--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=proS PE=3 SV=1 15 238 2.0E-46
sp|A8FKW6|SYP_CAMJ8 Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=proS PE=3 SV=1 15 238 2.0E-46
sp|Q17W62|SYP_HELAH Proline--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=proS PE=3 SV=1 15 228 3.0E-46
sp|Q9PHX1|SYP_CAMJE Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=proS PE=3 SV=1 15 238 3.0E-46
sp|A3M8I1|SYP_ACIBT Proline--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=proS PE=3 SV=2 15 230 3.0E-46
sp|B2HY33|SYP_ACIBC Proline--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=proS PE=3 SV=1 15 230 3.0E-46
sp|B0V4Y6|SYP_ACIBY Proline--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=proS PE=3 SV=1 15 230 3.0E-46
sp|B7I854|SYP_ACIB5 Proline--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=proS PE=3 SV=1 15 230 3.0E-46
sp|B7GWV6|SYP_ACIB3 Proline--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=proS PE=3 SV=1 15 230 3.0E-46
sp|Q30Z93|SYP_DESAG Proline--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=proS PE=3 SV=1 1 228 3.0E-46
sp|A1RI33|SYP_SHESW Proline--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=proS PE=3 SV=1 15 228 3.0E-46
sp|A0RNT1|SYP_CAMFF Proline--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=proS PE=3 SV=1 15 233 3.0E-46
sp|B4F249|SYP_PROMH Proline--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=proS PE=3 SV=1 15 231 4.0E-46
sp|A4Y8F6|SYP_SHEPC Proline--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=proS PE=3 SV=1 15 228 4.0E-46
sp|B1XT38|SYP_POLNS Proline--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=proS PE=3 SV=1 15 232 4.0E-46
sp|B2S2A7|SYP_TREPS Proline--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=proS PE=3 SV=1 15 282 4.0E-46
sp|O83195|SYP_TREPA Proline--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=proS PE=3 SV=1 15 282 4.0E-46
sp|Q47Z50|SYP_COLP3 Proline--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=proS PE=3 SV=1 15 267 4.0E-46
sp|A7I1R8|SYP_CAMHC Proline--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=proS PE=3 SV=1 15 234 4.0E-46
sp|A1VK86|SYP_POLNA Proline--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=proS PE=3 SV=1 15 232 4.0E-46
sp|B8EDD0|SYP_SHEB2 Proline--tRNA ligase OS=Shewanella baltica (strain OS223) GN=proS PE=3 SV=1 15 228 4.0E-46
sp|A3D6H7|SYP_SHEB5 Proline--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=proS PE=3 SV=1 15 228 5.0E-46
sp|A8F3T2|SYP_PSELT Proline--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=proS PE=3 SV=1 2 238 5.0E-46
sp|A9N9Z2|SYP_COXBR Proline--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=proS PE=3 SV=1 15 234 5.0E-46
sp|A9KVR8|SYP_SHEB9 Proline--tRNA ligase OS=Shewanella baltica (strain OS195) GN=proS PE=3 SV=1 15 228 5.0E-46
sp|A6WQB8|SYP_SHEB8 Proline--tRNA ligase OS=Shewanella baltica (strain OS185) GN=proS PE=3 SV=1 15 228 5.0E-46
sp|A9KGU5|SYP_COXBN Proline--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=proS PE=3 SV=1 15 234 5.0E-46
sp|A1JP53|SYP_YERE8 Proline--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=proS PE=3 SV=1 15 232 6.0E-46
sp|Q83F67|SYP_COXBU Proline--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=proS PE=3 SV=1 15 234 6.0E-46
sp|Q2NRN0|SYP_SODGM Proline--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=proS PE=3 SV=1 15 226 6.0E-46
sp|O31755|SYP_BACSU Proline--tRNA ligase OS=Bacillus subtilis (strain 168) GN=proS PE=3 SV=1 15 234 6.0E-46
sp|Q0HKJ4|SYP_SHESM Proline--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=proS PE=3 SV=1 15 228 7.0E-46
sp|Q0HWU6|SYP_SHESR Proline--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=proS PE=3 SV=1 15 228 7.0E-46
sp|B0BT03|SYP_ACTPJ Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=proS PE=3 SV=1 15 232 8.0E-46
sp|C0QY98|SYP_BRAHW Proline--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=proS PE=3 SV=1 1 234 8.0E-46
sp|A0KV13|SYP_SHESA Proline--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=proS PE=3 SV=1 15 228 8.0E-46
sp|A8ERT9|SYP_ARCB4 Proline--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 15 228 8.0E-46
sp|A0JUT1|SYP_ARTS2 Proline--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=proS PE=3 SV=1 15 237 9.0E-46
sp|Q1LIQ4|SYP_CUPMC Proline--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=proS PE=3 SV=2 15 230 9.0E-46
sp|Q8ECI8|SYP_SHEON Proline--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=proS PE=3 SV=1 15 228 9.0E-46
sp|A4W6T9|SYP_ENT38 Proline--tRNA ligase OS=Enterobacter sp. (strain 638) GN=proS PE=3 SV=1 15 228 1.0E-45
sp|B4SJ64|SYP_STRM5 Proline--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=proS PE=3 SV=1 15 213 1.0E-45
sp|Q667L4|SYP_YERPS Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=proS PE=3 SV=1 15 232 1.0E-45
sp|B2JZ09|SYP_YERPB Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=proS PE=3 SV=1 15 232 1.0E-45
sp|Q0AB94|SYP_ALKEH Proline--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=proS PE=3 SV=1 15 230 1.0E-45
sp|B9LA07|SYP_NAUPA Proline--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=proS PE=3 SV=1 15 235 1.0E-45
sp|A1T7H2|SYP_MYCVP Proline--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=proS PE=3 SV=1 15 226 1.0E-45
sp|B2FMR5|SYP_STRMK Proline--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=proS PE=3 SV=1 15 213 1.0E-45
sp|C3PH25|SYP_CORA7 Proline--tRNA ligase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=proS PE=3 SV=1 15 292 1.0E-45
sp|Q9KA71|SYP_BACHD Proline--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=proS PE=3 SV=1 15 230 1.0E-45
sp|Q03YC4|SYP_LEUMM Proline--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=proS PE=3 SV=1 1 234 1.0E-45
sp|B1MD96|SYP_MYCA9 Proline--tRNA ligase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=proS PE=3 SV=1 15 232 1.0E-45
sp|B3E1X5|SYP_GEOLS Proline--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=proS PE=3 SV=1 15 228 1.0E-45
sp|Q1LSM8|SYP_BAUCH Proline--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=proS PE=3 SV=1 14 202 2.0E-45
sp|A4TL66|SYP_YERPP Proline--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=proS PE=3 SV=1 15 232 2.0E-45
sp|B1JQI5|SYP_YERPY Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=proS PE=3 SV=1 15 232 2.0E-45
sp|Q1CFH2|SYP_YERPN Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=proS PE=3 SV=1 15 232 2.0E-45
sp|A9R371|SYP_YERPG Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=proS PE=3 SV=1 15 232 2.0E-45
sp|Q7CH25|SYP_YERPE Proline--tRNA ligase OS=Yersinia pestis GN=proS PE=3 SV=1 15 232 2.0E-45
sp|Q1CAK9|SYP_YERPA Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=proS PE=3 SV=1 15 232 2.0E-45
sp|A7FFJ4|SYP_YERP3 Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=proS PE=3 SV=1 15 232 2.0E-45
sp|B0VRW9|SYP_ACIBS Proline--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=proS PE=3 SV=1 15 230 2.0E-45
sp|A0QIY9|SYP_MYCA1 Proline--tRNA ligase OS=Mycobacterium avium (strain 104) GN=proS PE=3 SV=1 15 231 2.0E-45
sp|Q73VU8|SYP_MYCPA Proline--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=proS PE=3 SV=1 15 231 2.0E-45
sp|Q3JCN7|SYP_NITOC Proline--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=proS PE=3 SV=1 15 230 2.0E-45
sp|Q92C35|SYP_LISIN Proline--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=proS PE=3 SV=1 15 228 3.0E-45
sp|A7GYU6|SYP_CAMC5 Proline--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=proS PE=3 SV=1 15 233 4.0E-45
sp|A3N3C6|SYP_ACTP2 Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=proS PE=3 SV=1 15 232 4.0E-45
sp|Q04F81|SYP_OENOB Proline--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=proS PE=3 SV=1 1 228 4.0E-45
sp|Q5WFT6|SYP_BACSK Proline--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=proS PE=3 SV=1 15 231 4.0E-45
sp|Q7VKI5|SYP_HAEDU Proline--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=proS PE=3 SV=1 15 232 4.0E-45
sp|C3LTC5|SYP_VIBCM Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=proS PE=3 SV=1 15 232 4.0E-45
sp|Q9KTM7|SYP_VIBCH Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=proS PE=3 SV=1 15 232 4.0E-45
sp|A5F340|SYP_VIBC3 Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=proS PE=3 SV=1 15 232 4.0E-45
sp|B3GZ82|SYP_ACTP7 Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=proS PE=3 SV=1 15 232 5.0E-45
sp|B2KCB2|SYP_ELUMP Proline--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=proS PE=3 SV=1 1 228 5.0E-45
sp|C4XTD0|SYP_DESMR Proline--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=proS PE=3 SV=1 15 237 5.0E-45
sp|Q21MA8|SYP_SACD2 Proline--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=proS PE=3 SV=1 15 232 6.0E-45
sp|A5EXK9|SYP_DICNV Proline--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=proS PE=3 SV=1 15 230 6.0E-45
sp|Q21YZ5|SYP_RHOFT Proline--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=proS PE=3 SV=2 15 232 6.0E-45
sp|Q049U9|SYP_LACDB Proline--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=proS PE=3 SV=1 15 230 6.0E-45
sp|Q1G9P3|SYP_LACDA Proline--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=proS PE=3 SV=1 15 230 6.0E-45
sp|A1APU5|SYP_PELPD Proline--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=proS PE=3 SV=1 15 228 6.0E-45
sp|A1K976|SYP_AZOSB Proline--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=proS PE=3 SV=1 18 230 7.0E-45
sp|Q606K3|SYP_METCA Proline--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=proS PE=3 SV=1 15 232 7.0E-45
sp|A6LJ40|SYP_THEM4 Proline--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=proS PE=3 SV=1 18 222 7.0E-45
sp|Q89AN7|SYP_BUCBP Proline--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=proS PE=3 SV=1 14 230 7.0E-45
sp|A6VXT1|SYP_MARMS Proline--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=proS PE=3 SV=1 15 230 8.0E-45
sp|Q3IGT7|SYP_PSEHT Proline--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=proS PE=3 SV=2 15 235 8.0E-45
sp|C5CFP9|SYP_KOSOT Proline--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=proS PE=3 SV=1 18 228 8.0E-45
sp|Q3KH16|SYP_PSEPF Proline--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=proS PE=3 SV=1 15 234 1.0E-44
sp|B8D7E1|SYP_BUCAT Proline--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=proS PE=3 SV=1 14 214 1.0E-44
sp|B8D937|SYP_BUCA5 Proline--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=proS PE=3 SV=1 14 214 1.0E-44
sp|P57333|SYP_BUCAI Proline--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=proS PE=3 SV=1 14 214 1.0E-44
sp|Q4KH98|SYP_PSEF5 Proline--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=proS PE=3 SV=1 15 234 1.0E-44
sp|Q87B25|SYP_XYLFT Proline--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=proS PE=3 SV=1 15 214 1.0E-44
sp|B2I7W6|SYP_XYLF2 Proline--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=proS PE=3 SV=1 15 214 1.0E-44
sp|A0PQB8|SYP_MYCUA Proline--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=proS PE=3 SV=1 15 231 1.0E-44
sp|B0U4A7|SYP_XYLFM Proline--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=proS PE=3 SV=1 15 214 1.0E-44
sp|A5CSZ7|SYP_CLAM3 Proline--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=proS PE=3 SV=1 15 231 1.0E-44
sp|B0RDZ1|SYP_CLAMS Proline--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=proS PE=3 SV=1 15 211 1.0E-44
sp|B8F7C2|SYP_HAEPS Proline--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=proS PE=3 SV=1 15 232 1.0E-44
sp|Q9PG57|SYP_XYLFA Proline--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=proS PE=3 SV=2 15 214 1.0E-44
sp|Q82K46|SYP1_STRAW Proline--tRNA ligase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=proS1 PE=3 SV=1 15 226 1.0E-44
sp|B1VGB6|SYP_CORU7 Proline--tRNA ligase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=proS PE=3 SV=1 15 230 1.0E-44
sp|Q6FE23|SYP_ACIAD Proline--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=proS PE=3 SV=1 15 230 2.0E-44
sp|A0LV31|SYP_ACIC1 Proline--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=proS PE=3 SV=1 15 226 2.0E-44
sp|Q4JV46|SYP_CORJK Proline--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=proS PE=3 SV=1 15 292 2.0E-44
sp|Q7P0J3|SYP_CHRVO Proline--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=proS PE=3 SV=1 18 232 2.0E-44
sp|Q31GQ3|SYP_THICR Proline--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=proS PE=3 SV=1 15 232 2.0E-44
sp|Q65JJ1|SYP_BACLD Proline--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=proS PE=3 SV=1 15 240 3.0E-44
sp|Q12FA3|SYP_POLSJ Proline--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=proS PE=3 SV=1 15 234 3.0E-44
sp|C1B2Z4|SYP_RHOOB Proline--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=proS PE=3 SV=1 15 234 3.0E-44
sp|A7N1W0|SYP_VIBCB Proline--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=proS PE=3 SV=1 15 232 3.0E-44
sp|B9KGB1|SYP_CAMLR Proline--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=proS PE=3 SV=1 15 238 3.0E-44
sp|A1W4B3|SYP_ACISJ Proline--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=proS PE=3 SV=1 15 232 3.0E-44
sp|B9ME00|SYP_ACIET Proline--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=proS PE=3 SV=1 15 232 3.0E-44
sp|A8GIB4|SYP_SERP5 Proline--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=proS PE=3 SV=1 15 232 4.0E-44
sp|Q9CL72|SYP_PASMU Proline--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=proS PE=3 SV=1 15 232 4.0E-44
sp|C5C9S6|SYP_MICLC Proline--tRNA ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=proS PE=3 SV=1 15 211 4.0E-44
sp|A1WKI1|SYP_VEREI Proline--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=proS PE=3 SV=1 15 232 4.0E-44
sp|Q1BAA0|SYP_MYCSS Proline--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=proS PE=3 SV=1 15 226 4.0E-44
sp|A1UER2|SYP_MYCSK Proline--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=proS PE=3 SV=1 15 226 4.0E-44
sp|A4X5V6|SYP_SALTO Proline--tRNA ligase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=proS PE=3 SV=1 13 228 4.0E-44
sp|A1TTD0|SYP_ACIAC Proline--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=proS PE=3 SV=1 15 234 5.0E-44
sp|Q6A7L9|SYP_PROAC Proline--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=proS PE=3 SV=1 15 211 6.0E-44
sp|Q5NF37|SYP_FRATT Proline--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=proS PE=3 SV=1 15 231 6.0E-44
sp|Q14GJ0|SYP_FRAT1 Proline--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=proS PE=3 SV=1 15 231 6.0E-44
sp|B5YKW0|SYP_THEYD Proline--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=proS PE=3 SV=1 15 230 6.0E-44
sp|A1AW17|SYP_RUTMC Proline--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=proS PE=3 SV=1 15 235 6.0E-44
sp|A4IWT9|SYP_FRATW Proline--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=proS PE=3 SV=1 15 231 7.0E-44
sp|Q0BMT1|SYP_FRATO Proline--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=proS PE=3 SV=1 15 231 7.0E-44
sp|Q2A4E9|SYP_FRATH Proline--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=proS PE=3 SV=1 15 231 7.0E-44
sp|A7NB07|SYP_FRATF Proline--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=proS PE=3 SV=1 15 231 7.0E-44
sp|A0Q7N3|SYP_FRATN Proline--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=proS PE=3 SV=1 15 231 7.0E-44
sp|B2SFQ6|SYP_FRATM Proline--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=proS PE=3 SV=1 15 231 7.0E-44
sp|Q7MIE5|SYP_VIBVY Proline--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=proS PE=3 SV=1 15 232 8.0E-44
sp|Q8DBH9|SYP_VIBVU Proline--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=proS PE=3 SV=1 15 232 8.0E-44
sp|B1MY62|SYP_LEUCK Proline--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=proS PE=3 SV=1 1 235 9.0E-44
sp|C0ZF57|SYP_BREBN Proline--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=proS PE=3 SV=1 15 228 9.0E-44
sp|B5Y8J7|SYP_COPPD Proline--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=proS PE=3 SV=1 15 231 1.0E-43
sp|Q8CST7|SYP_STAES Proline--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=proS PE=3 SV=1 1 228 1.0E-43
sp|Q5HPS8|SYP_STAEQ Proline--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=proS PE=3 SV=1 1 228 1.0E-43
sp|Q6LN48|SYP_PHOPR Proline--tRNA ligase OS=Photobacterium profundum GN=proS PE=3 SV=1 15 232 1.0E-43
sp|Q1H497|SYP_METFK Proline--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=proS PE=3 SV=1 15 234 1.0E-43
sp|C5CXW9|SYP_VARPS Proline--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=proS PE=3 SV=1 15 228 1.0E-43
sp|B7VIT2|SYP_VIBTL Proline--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=proS PE=3 SV=1 15 232 1.0E-43
sp|A9BP65|SYP_DELAS Proline--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=proS PE=3 SV=1 15 228 1.0E-43
sp|Q3SH24|SYP_THIDA Proline--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=proS PE=3 SV=2 15 216 2.0E-43
sp|P9WFT9|SYP_MYCTU Proline--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=proS PE=1 SV=1 15 231 2.0E-43
sp|P9WFT8|SYP_MYCTO Proline--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=proS PE=3 SV=1 15 231 2.0E-43
sp|C4K3K4|SYP_HAMD5 Proline--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=proS PE=3 SV=1 15 230 2.0E-43
sp|Q038L9|SYP_LACC3 Proline--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=proS PE=3 SV=1 15 240 2.0E-43
sp|Q7VFF0|SYP_HELHP Proline--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=proS PE=3 SV=1 15 231 2.0E-43
sp|A4G8R0|SYP_HERAR Proline--tRNA ligase OS=Herminiimonas arsenicoxydans GN=proS PE=3 SV=1 15 248 2.0E-43
sp|C0ZY88|SYP_RHOE4 Proline--tRNA ligase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=proS PE=3 SV=1 15 226 2.0E-43
sp|Q6AEX8|SYP_LEIXX Proline--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=proS PE=3 SV=1 15 226 2.0E-43
sp|Q0S235|SYP1_RHOJR Proline--tRNA ligase 1 OS=Rhodococcus jostii (strain RHA1) GN=proS1 PE=3 SV=1 15 234 3.0E-43
sp|Q74IS2|SYP_LACJO Proline--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=proS PE=3 SV=1 1 241 3.0E-43
sp|B1XYW5|SYP_LEPCP Proline--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=proS PE=3 SV=1 15 232 3.0E-43
sp|A5CX68|SYP_VESOH Proline--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=proS PE=3 SV=1 15 235 4.0E-43
sp|Q5E719|SYP_VIBF1 Proline--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=proS PE=3 SV=2 15 232 4.0E-43
sp|Q493B4|SYP_BLOPB Proline--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=proS PE=3 SV=1 14 215 5.0E-43
sp|A2SD40|SYP_METPP Proline--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=proS PE=3 SV=1 15 226 6.0E-43
sp|Q4L5W5|SYP_STAHJ Proline--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=proS PE=3 SV=1 1 228 6.0E-43
sp|B5FBD6|SYP_VIBFM Proline--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=proS PE=3 SV=1 15 232 6.0E-43
sp|Q8G3N0|SYP_BIFLO Proline--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=proS PE=3 SV=1 18 216 6.0E-43
sp|Q88VK1|SYP_LACPL Proline--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=proS PE=3 SV=1 15 228 6.0E-43
sp|A2BPZ0|SYP_PROMS Proline--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=proS PE=3 SV=1 15 234 6.0E-43
sp|Q044C3|SYP_LACGA Proline--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=proS PE=3 SV=1 1 230 8.0E-43
sp|Q5FJN0|SYP_LACAC Proline--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=proS PE=3 SV=1 1 230 8.0E-43
sp|B9IVA8|SYP_BACCQ Proline--tRNA ligase OS=Bacillus cereus (strain Q1) GN=proS PE=3 SV=1 272 438 2.0E-32
sp|Q819Y4|SYP1_BACCR Proline--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=proS1 PE=3 SV=1 272 438 3.0E-32
sp|B7HLF2|SYP_BACC7 Proline--tRNA ligase OS=Bacillus cereus (strain AH187) GN=proS PE=3 SV=1 272 438 3.0E-32
sp|Q732Q0|SYP1_BACC1 Proline--tRNA ligase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=proS1 PE=3 SV=1 272 438 3.0E-32
sp|Q6HEZ6|SYP1_BACHK Proline--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=proS1 PE=3 SV=1 272 438 3.0E-32
sp|C1EP43|SYP_BACC3 Proline--tRNA ligase OS=Bacillus cereus (strain 03BB102) GN=proS PE=3 SV=1 272 438 3.0E-32
sp|B7JJ97|SYP_BACC0 Proline--tRNA ligase OS=Bacillus cereus (strain AH820) GN=proS PE=3 SV=1 272 438 3.0E-32
sp|C3L7A8|SYP_BACAC Proline--tRNA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=proS PE=3 SV=1 272 438 3.0E-32
sp|C3P5M1|SYP_BACAA Proline--tRNA ligase OS=Bacillus anthracis (strain A0248) GN=proS PE=3 SV=1 272 438 3.0E-32
sp|Q81WL6|SYP1_BACAN Proline--tRNA ligase 1 OS=Bacillus anthracis GN=proS1 PE=3 SV=1 272 438 3.0E-32
sp|A0RHJ2|SYP1_BACAH Proline--tRNA ligase 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=proS1 PE=3 SV=1 272 438 3.0E-32
sp|A9VT57|SYP_BACWK Proline--tRNA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=proS PE=3 SV=1 272 438 3.0E-32
sp|B7HDU2|SYP_BACC4 Proline--tRNA ligase OS=Bacillus cereus (strain B4264) GN=proS PE=3 SV=1 272 438 4.0E-32
sp|Q636K7|SYP1_BACCZ Proline--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=proS1 PE=3 SV=1 272 438 4.0E-32
sp|A0KPA5|SYP_AERHH Proline--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=proS PE=3 SV=1 270 434 1.0E-31
sp|B7IUH7|SYP_BACC2 Proline--tRNA ligase OS=Bacillus cereus (strain G9842) GN=proS PE=3 SV=1 272 438 1.0E-31
sp|A7GRE9|SYP_BACCN Proline--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=proS PE=3 SV=1 273 438 2.0E-31
sp|A4SJ23|SYP_AERS4 Proline--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=proS PE=3 SV=1 270 434 4.0E-31
sp|A0L8I2|SYP_MAGMM Proline--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=proS PE=3 SV=1 267 430 2.0E-30
sp|B9LA07|SYP_NAUPA Proline--tRNA ligase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=proS PE=3 SV=1 266 408 2.0E-30
sp|Q7M8L1|SYP_WOLSU Proline--tRNA ligase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=proS PE=3 SV=1 267 405 4.0E-30
sp|Q5QW31|SYP_IDILO Proline--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=proS PE=3 SV=1 270 434 6.0E-30
sp|A3M8I1|SYP_ACIBT Proline--tRNA ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=proS PE=3 SV=2 273 415 6.0E-30
sp|B2HY33|SYP_ACIBC Proline--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=proS PE=3 SV=1 273 415 6.0E-30
sp|B0V4Y6|SYP_ACIBY Proline--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=proS PE=3 SV=1 273 415 6.0E-30
sp|B7I854|SYP_ACIB5 Proline--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=proS PE=3 SV=1 273 415 6.0E-30
sp|B7GWV6|SYP_ACIB3 Proline--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=proS PE=3 SV=1 273 415 6.0E-30
sp|O66690|SYP_AQUAE Proline--tRNA ligase OS=Aquifex aeolicus (strain VF5) GN=proS PE=1 SV=1 253 440 1.0E-29
sp|A6Q7Y7|SYP_SULNB Proline--tRNA ligase OS=Sulfurovum sp. (strain NBC37-1) GN=proS PE=3 SV=1 267 438 2.0E-29
sp|Q3IGT7|SYP_PSEHT Proline--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=proS PE=3 SV=2 270 420 2.0E-29
sp|Q88VK1|SYP_LACPL Proline--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=proS PE=3 SV=1 273 420 5.0E-29
sp|B5EKH7|SYP_ACIF5 Proline--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=proS PE=3 SV=1 267 402 6.0E-29
sp|B7J4Y9|SYP_ACIF2 Proline--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=proS PE=3 SV=1 267 402 6.0E-29
sp|C3LTC5|SYP_VIBCM Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=proS PE=3 SV=1 270 434 6.0E-29
sp|Q9KTM7|SYP_VIBCH Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=proS PE=3 SV=1 270 434 6.0E-29
sp|A5F340|SYP_VIBC3 Proline--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=proS PE=3 SV=1 270 434 6.0E-29
sp|A1K976|SYP_AZOSB Proline--tRNA ligase OS=Azoarcus sp. (strain BH72) GN=proS PE=3 SV=1 273 415 7.0E-29
sp|B0VRW9|SYP_ACIBS Proline--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=proS PE=3 SV=1 273 415 1.0E-28
sp|Q31GQ3|SYP_THICR Proline--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=proS PE=3 SV=1 270 415 1.0E-28
sp|C5B780|SYP_EDWI9 Proline--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|Q667L4|SYP_YERPS Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|B2JZ09|SYP_YERPB Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|B1JQI5|SYP_YERPY Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|Q1CFH2|SYP_YERPN Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|A9R371|SYP_YERPG Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|Q7CH25|SYP_YERPE Proline--tRNA ligase OS=Yersinia pestis GN=proS PE=3 SV=1 273 434 2.0E-28
sp|Q1CAK9|SYP_YERPA Proline--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|A7FFJ4|SYP_YERP3 Proline--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=proS PE=3 SV=1 273 434 2.0E-28
sp|Q6FE23|SYP_ACIAD Proline--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=proS PE=3 SV=1 273 415 2.0E-28
sp|B5FBD6|SYP_VIBFM Proline--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=proS PE=3 SV=1 270 413 2.0E-28
sp|Q0AYJ4|SYP_SYNWW Proline--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=proS PE=3 SV=1 267 418 3.0E-28
sp|A6VKR5|SYP_ACTSZ Proline--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=proS PE=3 SV=1 273 440 3.0E-28
sp|A4TL66|SYP_YERPP Proline--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=proS PE=3 SV=1 273 434 3.0E-28
sp|B5Y8J7|SYP_COPPD Proline--tRNA ligase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=proS PE=3 SV=1 267 403 3.0E-28
sp|Q5E719|SYP_VIBF1 Proline--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=proS PE=3 SV=2 270 425 3.0E-28
sp|A8AL94|SYP_CITK8 Proline--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=proS PE=3 SV=1 273 438 4.0E-28
sp|Q6LN48|SYP_PHOPR Proline--tRNA ligase OS=Photobacterium profundum GN=proS PE=3 SV=1 270 404 5.0E-28
sp|B9LZK1|SYP_GEODF Proline--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=proS PE=3 SV=1 267 420 6.0E-28
sp|B0K5F2|SYP_THEPX Proline--tRNA ligase OS=Thermoanaerobacter sp. (strain X514) GN=proS PE=3 SV=1 266 415 6.0E-28
sp|B7NKX8|SYP_ECO7I Proline--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=proS PE=3 SV=1 273 438 6.0E-28
sp|B0KCH5|SYP_THEP3 Proline--tRNA ligase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=proS PE=3 SV=1 266 415 6.0E-28
sp|B4U8B2|SYP_HYDS0 Proline--tRNA ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=proS PE=3 SV=1 267 408 7.0E-28
sp|Q47Z50|SYP_COLP3 Proline--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=proS PE=3 SV=1 270 426 7.0E-28
sp|Q97ED5|SYP_CLOAB Proline--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=proS PE=3 SV=1 266 418 8.0E-28
sp|Q6D1B9|SYP_PECAS Proline--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=proS PE=3 SV=1 273 434 9.0E-28
sp|Q0VRL1|SYP_ALCBS Proline--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=proS PE=3 SV=2 272 434 9.0E-28
sp|C6DDF6|SYP_PECCP Proline--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=proS PE=3 SV=1 273 434 9.0E-28
sp|Q1RFZ4|SYP_ECOUT Proline--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=proS PE=3 SV=2 273 438 1.0E-27
sp|B1LGZ7|SYP_ECOSM Proline--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|Q8FKZ4|SYP_ECOL6 Proline--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=proS PE=3 SV=2 273 438 1.0E-27
sp|Q0TLD7|SYP_ECOL5 Proline--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|A1A7N8|SYP_ECOK1 Proline--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B7MP55|SYP_ECO81 Proline--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B7MBH6|SYP_ECO45 Proline--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B7UJ96|SYP_ECO27 Proline--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B7N862|SYP_ECOLU Proline--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|Q32JR3|SYP_SHIDS Proline--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B5Z0H4|SYP_ECO5E Proline--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|Q8X8W2|SYP_ECO57 Proline--tRNA ligase OS=Escherichia coli O157:H7 GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B7LHA4|SYP_ECO55 Proline--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|Q3Z5G3|SYP_SHISS Proline--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|Q83MC8|SYP_SHIFL Proline--tRNA ligase OS=Shigella flexneri GN=proS PE=3 SV=4 273 438 1.0E-27
sp|Q0T815|SYP_SHIF8 Proline--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=proS PE=3 SV=2 273 438 1.0E-27
sp|Q325U6|SYP_SHIBS Proline--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B2U338|SYP_SHIB3 Proline--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B6HZR3|SYP_ECOSE Proline--tRNA ligase OS=Escherichia coli (strain SE11) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B1IQE6|SYP_ECOLC Proline--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|A7ZWE2|SYP_ECOHS Proline--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|B7M1Z9|SYP_ECO8A Proline--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|A7ZHT6|SYP_ECO24 Proline--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|A6Q3S4|SYP_NITSB Proline--tRNA ligase OS=Nitratiruptor sp. (strain SB155-2) GN=proS PE=3 SV=1 267 440 1.0E-27
sp|A0AIC0|SYP_LISW6 Proline--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=proS PE=3 SV=1 273 435 1.0E-27
sp|A1JP53|SYP_YERE8 Proline--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=proS PE=3 SV=1 273 434 1.0E-27
sp|A4W6T9|SYP_ENT38 Proline--tRNA ligase OS=Enterobacter sp. (strain 638) GN=proS PE=3 SV=1 273 438 1.0E-27
sp|A8GIB4|SYP_SERP5 Proline--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=proS PE=3 SV=1 273 434 1.0E-27
sp|A4XHN7|SYP_CALS8 Proline--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=proS PE=3 SV=1 261 408 2.0E-27
sp|A6T4Z7|SYP_KLEP7 Proline--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=proS PE=3 SV=1 273 438 2.0E-27
sp|B7LW79|SYP_ESCF3 Proline--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=proS PE=3 SV=1 273 438 2.0E-27
sp|P16659|SYP_ECOLI Proline--tRNA ligase OS=Escherichia coli (strain K12) GN=proS PE=1 SV=4 273 438 2.0E-27
sp|B1XD64|SYP_ECODH Proline--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=proS PE=3 SV=1 273 438 2.0E-27
sp|C4ZRT7|SYP_ECOBW Proline--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=proS PE=3 SV=1 273 438 2.0E-27
sp|Q03YC4|SYP_LEUMM Proline--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=proS PE=3 SV=1 273 422 2.0E-27
sp|A6VXT1|SYP_MARMS Proline--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=proS PE=3 SV=1 273 434 2.0E-27
sp|Q65JJ1|SYP_BACLD Proline--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=proS PE=3 SV=1 273 441 2.0E-27
sp|Q15WD6|SYP_PSEA6 Proline--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=proS PE=3 SV=1 273 434 3.0E-27
sp|B2VDZ9|SYP_ERWT9 Proline--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=proS PE=3 SV=1 273 434 3.0E-27
sp|B0BT03|SYP_ACTPJ Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=proS PE=3 SV=1 273 440 3.0E-27
sp|Q92C35|SYP_LISIN Proline--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=proS PE=3 SV=1 273 435 3.0E-27
sp|A3N3C6|SYP_ACTP2 Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=proS PE=3 SV=1 273 440 3.0E-27
sp|A7H4J9|SYP_CAMJD Proline--tRNA ligase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=proS PE=3 SV=1 267 438 4.0E-27
sp|B3GZ82|SYP_ACTP7 Proline--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=proS PE=3 SV=1 273 440 4.0E-27
sp|Q7MIE5|SYP_VIBVY Proline--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=proS PE=3 SV=1 270 434 4.0E-27
sp|Q8DBH9|SYP_VIBVU Proline--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=proS PE=3 SV=1 270 426 4.0E-27
sp|B9MPD7|SYP_CALBD Proline--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=proS PE=3 SV=1 261 404 5.0E-27
sp|A3DJL6|SYP_CLOTH Proline--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=proS PE=3 SV=1 267 404 5.0E-27
sp|B2V6W5|SYP_SULSY Proline--tRNA ligase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=proS PE=3 SV=1 247 423 6.0E-27
sp|Q8R7S9|SYP_CALS4 Proline--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=proS PE=3 SV=1 266 408 6.0E-27
sp|B3E1X5|SYP_GEOLS Proline--tRNA ligase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=proS PE=3 SV=1 267 440 6.0E-27
sp|Q890M2|SYP_CLOTE Proline--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=proS PE=3 SV=1 266 408 7.0E-27
sp|Q6AP31|SYP_DESPS Proline--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=proS PE=3 SV=1 267 440 7.0E-27
sp|A8H6J5|SYP_SHEPA Proline--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=proS PE=3 SV=1 270 434 7.0E-27
sp|B5Y1H7|SYP_KLEP3 Proline--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=proS PE=3 SV=1 273 438 7.0E-27
sp|B0THP0|SYP_HELMI Proline--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=proS PE=3 SV=1 267 438 7.0E-27
sp|B4RV73|SYP_ALTMD Proline--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=proS PE=3 SV=1 273 434 8.0E-27
sp|A4J5Y2|SYP_DESRM Proline--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=proS PE=3 SV=1 267 415 8.0E-27
sp|A1VYQ2|SYP_CAMJJ Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=proS PE=3 SV=1 267 438 8.0E-27
sp|O31755|SYP_BACSU Proline--tRNA ligase OS=Bacillus subtilis (strain 168) GN=proS PE=3 SV=1 273 436 8.0E-27
sp|A4G8R0|SYP_HERAR Proline--tRNA ligase OS=Herminiimonas arsenicoxydans GN=proS PE=3 SV=1 273 434 8.0E-27
sp|B7VIT2|SYP_VIBTL Proline--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=proS PE=3 SV=1 270 426 9.0E-27
sp|A9BGA8|SYP_PETMO Proline--tRNA ligase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=proS PE=3 SV=1 266 408 1.0E-26
sp|C4LBX6|SYP_TOLAT Proline--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=proS PE=3 SV=1 270 434 1.0E-26
sp|B4SV24|SYP_SALNS Proline--tRNA ligase OS=Salmonella newport (strain SL254) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B5F8V6|SYP_SALA4 Proline--tRNA ligase OS=Salmonella agona (strain SL483) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|A9MPG5|SYP_SALAR Proline--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|Q7CR62|SYP_SALTY Proline--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|Q8XEY9|SYP_SALTI Proline--tRNA ligase OS=Salmonella typhi GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B5BAQ2|SYP_SALPK Proline--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|A9N0U7|SYP_SALPB Proline--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|Q5PD80|SYP_SALPA Proline--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B4TK70|SYP_SALHS Proline--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B5R5J8|SYP_SALG2 Proline--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B5R434|SYP_SALEP Proline--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B5FJ42|SYP_SALDC Proline--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|B4TYF5|SYP_SALSV Proline--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|Q57T14|SYP_SALCH Proline--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=proS PE=3 SV=2 273 438 1.0E-26
sp|C0Q6L7|SYP_SALPC Proline--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=proS PE=3 SV=1 273 438 1.0E-26
sp|A7ZD35|SYP_CAMC1 Proline--tRNA ligase OS=Campylobacter concisus (strain 13826) GN=proS PE=3 SV=1 266 406 1.0E-26
sp|Q2LTR7|SYP_SYNAS Proline--tRNA ligase OS=Syntrophus aciditrophicus (strain SB) GN=proS PE=3 SV=2 267 439 1.0E-26
sp|Q5HVM3|SYP_CAMJR Proline--tRNA ligase OS=Campylobacter jejuni (strain RM1221) GN=proS PE=3 SV=1 267 438 1.0E-26
sp|A8FKW6|SYP_CAMJ8 Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=proS PE=3 SV=1 267 438 1.0E-26
sp|B4F249|SYP_PROMH Proline--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=proS PE=3 SV=1 273 426 1.0E-26
sp|Q2NRN0|SYP_SODGM Proline--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=proS PE=3 SV=1 272 440 1.0E-26
sp|Q9CL72|SYP_PASMU Proline--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=proS PE=3 SV=1 273 430 1.0E-26
sp|B8CW65|SYP_HALOH Proline--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=proS PE=3 SV=1 266 441 2.0E-26
sp|C6E496|SYP_GEOSM Proline--tRNA ligase OS=Geobacter sp. (strain M21) GN=proS PE=3 SV=1 267 403 2.0E-26
sp|B2JHD3|SYP_BURP8 Proline--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=proS PE=3 SV=1 273 415 2.0E-26
sp|A4SVA7|SYP_POLSQ Proline--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=proS PE=3 SV=1 273 441 2.0E-26
sp|Q46X21|SYP_CUPPJ Proline--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=proS PE=3 SV=1 273 415 2.0E-26
sp|Q9KA71|SYP_BACHD Proline--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=proS PE=3 SV=1 273 437 2.0E-26
sp|A6LJ40|SYP_THEM4 Proline--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=proS PE=3 SV=1 267 408 2.0E-26
sp|Q39VY6|SYP_GEOMG Proline--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=proS PE=3 SV=1 267 441 3.0E-26
sp|B5EIT9|SYP_GEOBB Proline--tRNA ligase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=proS PE=3 SV=1 267 403 3.0E-26
sp|A4VNB4|SYP_PSEU5 Proline--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=proS PE=3 SV=1 273 435 3.0E-26
sp|Q9PHX1|SYP_CAMJE Proline--tRNA ligase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=proS PE=3 SV=1 267 438 3.0E-26
sp|B8F7C2|SYP_HAEPS Proline--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=proS PE=3 SV=1 273 434 3.0E-26
sp|Q038L9|SYP_LACC3 Proline--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=proS PE=3 SV=1 273 441 3.0E-26
sp|Q02IB8|SYP_PSEAB Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=proS PE=3 SV=1 273 439 4.0E-26
sp|B0TNJ5|SYP_SHEHH Proline--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=proS PE=3 SV=1 270 425 4.0E-26
sp|A8ERT9|SYP_ARCB4 Proline--tRNA ligase OS=Arcobacter butzleri (strain RM4018) GN=proS PE=3 SV=1 270 408 4.0E-26
sp|Q21YZ5|SYP_RHOFT Proline--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=proS PE=3 SV=2 273 403 4.0E-26
sp|B0SM58|SYP_LEPBP Proline--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=proS PE=3 SV=1 267 406 5.0E-26
sp|B0SDM9|SYP_LEPBA Proline--tRNA ligase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=proS PE=3 SV=1 267 406 5.0E-26
sp|A7MI22|SYP_CROS8 Proline--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=proS PE=3 SV=1 273 413 5.0E-26
sp|Q9I502|SYP_PSEAE Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=proS PE=3 SV=1 273 439 6.0E-26
sp|B7UXX6|SYP_PSEA8 Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=proS PE=3 SV=1 273 439 6.0E-26
sp|C1DRG4|SYP_AZOVD Proline--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=proS PE=3 SV=1 273 438 6.0E-26
sp|Q7N8M7|SYP_PHOLL Proline--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=proS PE=3 SV=1 273 415 6.0E-26
sp|A3QG64|SYP_SHELP Proline--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=proS PE=3 SV=1 270 434 7.0E-26
sp|A0RNT1|SYP_CAMFF Proline--tRNA ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=proS PE=3 SV=1 273 408 7.0E-26
sp|B2KCB2|SYP_ELUMP Proline--tRNA ligase OS=Elusimicrobium minutum (strain Pei191) GN=proS PE=3 SV=1 267 402 7.0E-26
sp|A7Z4S8|SYP_BACMF Proline--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=proS PE=3 SV=1 273 434 8.0E-26
sp|Q0K6Q0|SYP_CUPNH Proline--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=proS PE=3 SV=1 273 415 8.0E-26
sp|A7N1W0|SYP_VIBCB Proline--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=proS PE=3 SV=1 270 413 8.0E-26
sp|A5UHN3|SYP_HAEIG Proline--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=proS PE=3 SV=1 273 441 9.0E-26
sp|P43830|SYP_HAEIN Proline--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=proS PE=1 SV=1 273 441 9.0E-26
sp|Q30Z93|SYP_DESAG Proline--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=proS PE=3 SV=1 263 403 9.0E-26
sp|B1YSV1|SYP_BURA4 Proline--tRNA ligase OS=Burkholderia ambifaria (strain MC40-6) GN=proS PE=3 SV=1 273 415 1.0E-25
sp|A4IMD1|SYP_GEOTN Proline--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=proS PE=3 SV=1 272 420 1.0E-25
sp|A5UDZ4|SYP_HAEIE Proline--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=proS PE=3 SV=1 273 441 1.0E-25
sp|A6VA16|SYP_PSEA7 Proline--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=proS PE=3 SV=1 273 439 1.0E-25
sp|Q4QMG5|SYP_HAEI8 Proline--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=proS PE=3 SV=1 273 441 1.0E-25
sp|C1L2M5|SYP_LISMC Proline--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=proS PE=3 SV=1 273 435 1.0E-25
sp|Q8Y7G2|SYP_LISMO Proline--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=proS PE=3 SV=1 273 435 1.0E-25
sp|Q720A3|SYP_LISMF Proline--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=proS PE=3 SV=1 273 435 1.0E-25
sp|Q74D59|SYP_GEOSL Proline--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=proS PE=3 SV=1 267 420 1.0E-25
sp|B3R894|SYP_CUPTR Proline--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=proS PE=3 SV=1 273 415 1.0E-25
sp|B1MY62|SYP_LEUCK Proline--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=proS PE=3 SV=1 273 422 1.0E-25
sp|C5D9C3|SYP_GEOSW Proline--tRNA ligase OS=Geobacillus sp. (strain WCH70) GN=proS PE=3 SV=1 273 430 2.0E-25
sp|B2TIF5|SYP_CLOBB Proline--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=proS PE=3 SV=1 267 408 2.0E-25
sp|A3NDS2|SYP_BURP6 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=proS PE=3 SV=1 273 415 2.0E-25
sp|B1KNR3|SYP_SHEWM Proline--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=proS PE=3 SV=1 264 434 2.0E-25
sp|Q62GV8|SYP_BURMA Proline--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=proS PE=3 SV=1 273 415 2.0E-25
sp|B8DG08|SYP_LISMH Proline--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=proS PE=3 SV=1 273 435 2.0E-25
sp|B1YI68|SYP_EXIS2 Proline--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=proS PE=3 SV=1 273 408 2.0E-25
sp|Q21MA8|SYP_SACD2 Proline--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=proS PE=3 SV=1 270 440 2.0E-25
sp|Q4L5W5|SYP_STAHJ Proline--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=proS PE=3 SV=1 272 441 2.0E-25
sp|A9AI56|SYP_BURM1 Proline--tRNA ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|Q2SZF6|SYP_BURTA Proline--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|Q63QM5|SYP_BURPS Proline--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|Q3JNG4|SYP_BURP1 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|A3NZI6|SYP_BURP0 Proline--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|A1V0N6|SYP_BURMS Proline--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|A2S5R3|SYP_BURM9 Proline--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|A3MR95|SYP_BURM7 Proline--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=proS PE=3 SV=1 273 415 3.0E-25
sp|B8DNM5|SYP_DESVM Proline--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=proS PE=3 SV=1 267 403 3.0E-25
sp|Q4FUL6|SYP_PSYA2 Proline--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=proS PE=3 SV=1 273 402 3.0E-25
sp|B5YKW0|SYP_THEYD Proline--tRNA ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=proS PE=3 SV=1 263 414 3.0E-25
sp|Q1H497|SYP_METFK Proline--tRNA ligase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=proS PE=3 SV=1 273 426 3.0E-25
sp|B1XYW5|SYP_LEPCP Proline--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=proS PE=3 SV=1 273 434 3.0E-25
sp|A1WUX1|SYP_HALHL Proline--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=proS PE=3 SV=1 273 402 4.0E-25
sp|A6LPP0|SYP_CLOB8 Proline--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=proS PE=3 SV=1 266 408 4.0E-25
sp|B2SYU8|SYP_BURPP Proline--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=proS PE=3 SV=1 273 415 4.0E-25
sp|A1RI33|SYP_SHESW Proline--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=proS PE=3 SV=1 273 440 4.0E-25
sp|A4Y8F6|SYP_SHEPC Proline--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=proS PE=3 SV=1 273 440 4.0E-25
sp|A7GYU6|SYP_CAMC5 Proline--tRNA ligase OS=Campylobacter curvus (strain 525.92) GN=proS PE=3 SV=1 267 408 4.0E-25
sp|A1APU5|SYP_PELPD Proline--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=proS PE=3 SV=1 267 420 4.0E-25
sp|B2UY89|SYP_CLOBA Proline--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=proS PE=3 SV=1 267 408 5.0E-25
sp|Q0HKJ4|SYP_SHESM Proline--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=proS PE=3 SV=1 273 434 5.0E-25
sp|Q0HWU6|SYP_SHESR Proline--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=proS PE=3 SV=1 273 434 5.0E-25
sp|Q1LIQ4|SYP_CUPMC Proline--tRNA ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=proS PE=3 SV=2 273 415 5.0E-25
sp|Q8ECI8|SYP_SHEON Proline--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=proS PE=3 SV=1 273 434 5.0E-25
sp|Q606K3|SYP_METCA Proline--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=proS PE=3 SV=1 273 434 5.0E-25
sp|Q2RJN1|SYP_MOOTA Proline--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=proS PE=3 SV=1 267 418 6.0E-25
sp|A8FDC1|SYP_BACP2 Proline--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=proS PE=3 SV=1 273 434 6.0E-25
sp|Q65QU0|SYP_MANSM Proline--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=proS PE=3 SV=2 273 434 6.0E-25
sp|Q7P0J3|SYP_CHRVO Proline--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=proS PE=3 SV=1 273 430 6.0E-25
sp|C4K3K4|SYP_HAMD5 Proline--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=proS PE=3 SV=1 273 422 6.0E-25
sp|A0KV13|SYP_SHESA Proline--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=proS PE=3 SV=1 273 434 7.0E-25
sp|Q12FA3|SYP_POLSJ Proline--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=proS PE=3 SV=1 273 415 8.0E-25
sp|A2SD40|SYP_METPP Proline--tRNA ligase OS=Methylibium petroleiphilum (strain PM1) GN=proS PE=3 SV=1 273 415 8.0E-25
sp|Q13U19|SYP_BURXL Proline--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=proS PE=3 SV=1 273 415 9.0E-25
sp|C5BPN9|SYP_TERTT Proline--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=proS PE=3 SV=1 270 439 9.0E-25
sp|B1XT38|SYP_POLNS Proline--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=proS PE=3 SV=1 273 441 9.0E-25
sp|C0QTI8|SYP_PERMH Proline--tRNA ligase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=proS PE=3 SV=1 267 437 1.0E-24
sp|Q07ZH1|SYP_SHEFN Proline--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=proS PE=3 SV=1 273 434 1.0E-24
sp|Q1QDK7|SYP_PSYCK Proline--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=proS PE=3 SV=1 273 402 1.0E-24
sp|A7I1R8|SYP_CAMHC Proline--tRNA ligase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=proS PE=3 SV=1 267 427 1.0E-24
sp|A1VK86|SYP_POLNA Proline--tRNA ligase OS=Polaromonas naphthalenivorans (strain CJ2) GN=proS PE=3 SV=1 273 403 1.0E-24
sp|Q7VKI5|SYP_HAEDU Proline--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=proS PE=3 SV=1 273 436 1.0E-24
sp|A1W4B3|SYP_ACISJ Proline--tRNA ligase OS=Acidovorax sp. (strain JS42) GN=proS PE=3 SV=1 273 415 1.0E-24
sp|B9ME00|SYP_ACIET Proline--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=proS PE=3 SV=1 273 415 1.0E-24
sp|C0ZF57|SYP_BREBN Proline--tRNA ligase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=proS PE=3 SV=1 273 441 1.0E-24
sp|Q5L0J4|SYP_GEOKA Proline--tRNA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=proS PE=3 SV=1 273 420 2.0E-24
sp|B4E5W6|SYP_BURCJ Proline--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=proS PE=3 SV=1 261 415 2.0E-24
sp|Q0BIH4|SYP_BURCM Proline--tRNA ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=proS PE=3 SV=1 273 415 2.0E-24
sp|A4JBC2|SYP_BURVG Proline--tRNA ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=proS PE=3 SV=1 261 415 2.0E-24
sp|Q39JU3|SYP_BURL3 Proline--tRNA ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=proS PE=3 SV=1 261 415 2.0E-24
sp|Q5YSB9|SYP_NOCFA Proline--tRNA ligase OS=Nocardia farcinica (strain IFM 10152) GN=proS PE=3 SV=1 239 411 2.0E-24
sp|P56124|SYP_HELPY Proline--tRNA ligase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=proS PE=3 SV=1 266 404 2.0E-24
sp|B8EDD0|SYP_SHEB2 Proline--tRNA ligase OS=Shewanella baltica (strain OS223) GN=proS PE=3 SV=1 272 438 2.0E-24
sp|Q5WFT6|SYP_BACSK Proline--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=proS PE=3 SV=1 273 420 2.0E-24
sp|A5EXK9|SYP_DICNV Proline--tRNA ligase OS=Dichelobacter nodosus (strain VCS1703A) GN=proS PE=3 SV=1 273 402 2.0E-24
sp|Q3SH24|SYP_THIDA Proline--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=proS PE=3 SV=2 273 415 2.0E-24
sp|Q1MRD0|SYP_LAWIP Proline--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=proS PE=3 SV=1 263 420 3.0E-24
sp|A1S4R2|SYP_SHEAM Proline--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=proS PE=3 SV=1 273 434 3.0E-24
sp|A4XRQ7|SYP_PSEMY Proline--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=proS PE=3 SV=1 273 402 3.0E-24
sp|B6JKG9|SYP_HELP2 Proline--tRNA ligase OS=Helicobacter pylori (strain P12) GN=proS PE=3 SV=1 266 404 3.0E-24
sp|A6WQB8|SYP_SHEB8 Proline--tRNA ligase OS=Shewanella baltica (strain OS185) GN=proS PE=3 SV=1 273 438 3.0E-24
sp|B1HQZ9|SYP_LYSSC Proline--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=proS PE=3 SV=1 273 420 4.0E-24
sp|Q3AB89|SYP_CARHZ Proline--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=proS PE=3 SV=1 267 415 4.0E-24
sp|B8IZD1|SYP_DESDA Proline--tRNA ligase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=proS PE=3 SV=1 255 403 4.0E-24
sp|Q1BZD6|SYP_BURCA Proline--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=proS PE=3 SV=1 273 415 4.0E-24
sp|B5ZA05|SYP_HELPG Proline--tRNA ligase OS=Helicobacter pylori (strain G27) GN=proS PE=3 SV=1 267 404 4.0E-24
sp|Q1CUR4|SYP_HELPH Proline--tRNA ligase OS=Helicobacter pylori (strain HPAG1) GN=proS PE=3 SV=1 267 416 4.0E-24
sp|Q0AB94|SYP_ALKEH Proline--tRNA ligase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=proS PE=3 SV=1 273 434 4.0E-24
sp|A4X5V6|SYP_SALTO Proline--tRNA ligase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=proS PE=3 SV=1 267 441 4.0E-24
sp|Q6A7L9|SYP_PROAC Proline--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=proS PE=3 SV=1 253 426 4.0E-24
sp|B2SFQ6|SYP_FRATM Proline--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=proS PE=3 SV=1 270 415 4.0E-24
sp|A0K4B4|SYP_BURCH Proline--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=proS PE=3 SV=1 273 415 5.0E-24
sp|B1JVA5|SYP_BURCC Proline--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=proS PE=3 SV=1 273 415 5.0E-24
sp|Q3A6R6|SYP_PELCD Proline--tRNA ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=proS PE=3 SV=1 267 415 5.0E-24
sp|Q0I4S8|SYP_HAES1 Proline--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=proS PE=3 SV=1 273 440 5.0E-24
sp|B0UWK9|SYP_HISS2 Proline--tRNA ligase OS=Histophilus somni (strain 2336) GN=proS PE=3 SV=1 273 440 5.0E-24
sp|A3D6H7|SYP_SHEB5 Proline--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=proS PE=3 SV=1 272 425 5.0E-24
sp|A9BP65|SYP_DELAS Proline--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=proS PE=3 SV=1 273 415 5.0E-24
sp|Q04F81|SYP_OENOB Proline--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=proS PE=3 SV=1 273 441 6.0E-24
sp|Q8XHQ4|SYP_CLOPE Proline--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=proS PE=3 SV=1 266 404 7.0E-24
sp|Q0TMM3|SYP_CLOP1 Proline--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=proS PE=3 SV=1 266 404 7.0E-24
sp|Q0SQC0|SYP_CLOPS Proline--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=proS PE=3 SV=1 266 404 7.0E-24
sp|A9KVR8|SYP_SHEB9 Proline--tRNA ligase OS=Shewanella baltica (strain OS195) GN=proS PE=3 SV=1 272 438 7.0E-24
sp|B2US70|SYP_HELPS Proline--tRNA ligase OS=Helicobacter pylori (strain Shi470) GN=proS PE=3 SV=1 267 404 1.0E-23
sp|Q4ZWM2|SYP_PSEU2 Proline--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=proS PE=3 SV=1 273 437 1.0E-23
sp|Q48FB4|SYP_PSE14 Proline--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=proS PE=3 SV=1 273 437 1.0E-23
sp|Q9ZMJ6|SYP_HELPJ Proline--tRNA ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=proS PE=3 SV=1 267 404 1.0E-23
sp|Q053M7|SYP_LEPBL Proline--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=proS PE=3 SV=1 267 409 1.0E-23
sp|Q04U64|SYP_LEPBJ Proline--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=proS PE=3 SV=1 267 409 1.0E-23
sp|A8F3T2|SYP_PSELT Proline--tRNA ligase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=proS PE=3 SV=1 267 418 1.0E-23
sp|Q5NF37|SYP_FRATT Proline--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=proS PE=3 SV=1 273 415 1.0E-23
sp|Q14GJ0|SYP_FRAT1 Proline--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=proS PE=3 SV=1 273 415 1.0E-23
sp|A0Q7N3|SYP_FRATN Proline--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=proS PE=3 SV=1 273 415 1.0E-23
sp|C5CXW9|SYP_VARPS Proline--tRNA ligase OS=Variovorax paradoxus (strain S110) GN=proS PE=3 SV=1 273 439 1.0E-23
sp|B7IFB6|SYP_THEAB Proline--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=proS PE=3 SV=1 267 408 2.0E-23
sp|A5D2U6|SYP_PELTS Proline--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=proS PE=3 SV=1 267 441 2.0E-23
sp|A5WDG2|SYP_PSYWF Proline--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=proS PE=3 SV=1 273 402 2.0E-23
sp|Q17W62|SYP_HELAH Proline--tRNA ligase OS=Helicobacter acinonychis (strain Sheeba) GN=proS PE=3 SV=1 267 416 2.0E-23
sp|Q89AN7|SYP_BUCBP Proline--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=proS PE=3 SV=1 273 413 2.0E-23
sp|B8D7E1|SYP_BUCAT Proline--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=proS PE=3 SV=1 272 404 2.0E-23
sp|B8D937|SYP_BUCA5 Proline--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=proS PE=3 SV=1 272 404 2.0E-23
sp|P57333|SYP_BUCAI Proline--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=proS PE=3 SV=1 272 404 2.0E-23
sp|Q4JV46|SYP_CORJK Proline--tRNA ligase OS=Corynebacterium jeikeium (strain K411) GN=proS PE=3 SV=1 273 408 2.0E-23
sp|A1TTD0|SYP_ACIAC Proline--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=proS PE=3 SV=1 273 434 2.0E-23
sp|A4IWT9|SYP_FRATW Proline--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=proS PE=3 SV=1 273 415 2.0E-23
sp|Q8CST7|SYP_STAES Proline--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=proS PE=3 SV=1 272 441 2.0E-23
sp|Q5HPS8|SYP_STAEQ Proline--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=proS PE=3 SV=1 272 441 2.0E-23
sp|Q7VFF0|SYP_HELHP Proline--tRNA ligase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=proS PE=3 SV=1 257 408 2.0E-23
sp|A2BPZ0|SYP_PROMS Proline--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=proS PE=3 SV=1 275 415 2.0E-23
sp|Q87Y24|SYP_PSESM Proline--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=proS PE=3 SV=1 273 437 3.0E-23
sp|A7HKV2|SYP_FERNB Proline--tRNA ligase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=proS PE=3 SV=1 267 418 3.0E-23
sp|Q8G3N0|SYP_BIFLO Proline--tRNA ligase OS=Bifidobacterium longum (strain NCC 2705) GN=proS PE=3 SV=1 272 415 3.0E-23
sp|A1WKI1|SYP_VEREI Proline--tRNA ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=proS PE=3 SV=1 273 415 4.0E-23
sp|Q73KJ8|SYP_TREDE Proline--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=proS PE=3 SV=1 266 404 5.0E-23
sp|Q47ID0|SYP_DECAR Proline--tRNA ligase OS=Dechloromonas aromatica (strain RCB) GN=proS PE=3 SV=1 273 428 5.0E-23
sp|Q8F148|SYP_LEPIN Proline--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=proS PE=3 SV=1 267 406 6.0E-23
sp|C4XTD0|SYP_DESMR Proline--tRNA ligase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=proS PE=3 SV=1 267 403 7.0E-23
sp|Q4KH98|SYP_PSEF5 Proline--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=proS PE=3 SV=1 273 441 8.0E-23
sp|A1AW17|SYP_RUTMC Proline--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=proS PE=3 SV=1 273 415 8.0E-23
sp|Q72U06|SYP_LEPIC Proline--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=proS PE=3 SV=1 267 406 9.0E-23
sp|B9KBD7|SYP_THENN Proline--tRNA ligase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=proS PE=3 SV=1 267 408 1.0E-22
sp|Q83GR4|SYP_TROWT Proline--tRNA ligase OS=Tropheryma whipplei (strain Twist) GN=proS PE=3 SV=1 273 411 1.0E-22
sp|Q83HI1|SYP_TROW8 Proline--tRNA ligase OS=Tropheryma whipplei (strain TW08/27) GN=proS PE=3 SV=1 273 411 1.0E-22
sp|Q3JCN7|SYP_NITOC Proline--tRNA ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=proS PE=3 SV=1 273 415 1.0E-22
sp|Q1I6D7|SYP_PSEE4 Proline--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=proS PE=3 SV=1 273 402 2.0E-22
sp|A5VZT5|SYP_PSEP1 Proline--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=proS PE=3 SV=1 273 402 2.0E-22
sp|B1JD82|SYP_PSEPW Proline--tRNA ligase OS=Pseudomonas putida (strain W619) GN=proS PE=3 SV=1 273 402 2.0E-22
sp|B0KTK4|SYP_PSEPG Proline--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=proS PE=3 SV=1 273 402 2.0E-22
sp|Q0BMT1|SYP_FRATO Proline--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=proS PE=3 SV=1 273 415 2.0E-22
sp|Q2A4E9|SYP_FRATH Proline--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=proS PE=3 SV=1 273 415 2.0E-22
sp|A7NB07|SYP_FRATF Proline--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=proS PE=3 SV=1 273 415 2.0E-22
sp|C6BYX7|SYP_DESAD Proline--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=proS PE=3 SV=1 267 420 3.0E-22
sp|Q12L53|SYP_SHEDO Proline--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=proS PE=3 SV=1 273 425 3.0E-22
sp|Q3KH16|SYP_PSEPF Proline--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=proS PE=3 SV=1 273 441 3.0E-22
sp|A0PQB8|SYP_MYCUA Proline--tRNA ligase OS=Mycobacterium ulcerans (strain Agy99) GN=proS PE=3 SV=1 239 435 3.0E-22
sp|P9WFT9|SYP_MYCTU Proline--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=proS PE=1 SV=1 239 408 3.0E-22
sp|P9WFT8|SYP_MYCTO Proline--tRNA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=proS PE=3 SV=1 239 408 3.0E-22
sp|Q88NK2|SYP_PSEPK Proline--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=proS PE=3 SV=1 273 402 4.0E-22
sp|A9KGU5|SYP_COXBN Proline--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=proS PE=3 SV=1 273 416 4.0E-22
sp|A9N9Z2|SYP_COXBR Proline--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=proS PE=3 SV=1 273 416 5.0E-22
sp|Q83F67|SYP_COXBU Proline--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=proS PE=3 SV=1 273 416 6.0E-22
sp|A1VE74|SYP_DESVV Proline--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=proS PE=3 SV=1 267 403 1.0E-21
sp|B1I2J1|SYP_DESAP Proline--tRNA ligase OS=Desulforudis audaxviator (strain MP104C) GN=proS PE=3 SV=1 263 408 1.0E-21
sp|A0QIY9|SYP_MYCA1 Proline--tRNA ligase OS=Mycobacterium avium (strain 104) GN=proS PE=3 SV=1 239 441 1.0E-21
sp|Q73VU8|SYP_MYCPA Proline--tRNA ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=proS PE=3 SV=1 239 441 1.0E-21
sp|B1VGB6|SYP_CORU7 Proline--tRNA ligase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=proS PE=3 SV=1 239 406 1.0E-21
sp|Q1BAA0|SYP_MYCSS Proline--tRNA ligase OS=Mycobacterium sp. (strain MCS) GN=proS PE=3 SV=1 239 408 1.0E-21
sp|A1UER2|SYP_MYCSK Proline--tRNA ligase OS=Mycobacterium sp. (strain KMS) GN=proS PE=3 SV=1 239 408 1.0E-21
sp|Q72CD8|SYP_DESVH Proline--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=proS PE=3 SV=1 267 403 2.0E-21
sp|Q3Z9I5|SYP_DEHM1 Proline--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=proS PE=3 SV=1 246 415 2.0E-21
sp|C0QY98|SYP_BRAHW Proline--tRNA ligase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=proS PE=3 SV=1 266 404 2.0E-21
sp|C5CFP9|SYP_KOSOT Proline--tRNA ligase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=proS PE=3 SV=1 267 404 2.0E-21
sp|C0ZY88|SYP_RHOE4 Proline--tRNA ligase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=proS PE=3 SV=1 239 437 2.0E-21
sp|Q3ZZD0|SYP_DEHMC Proline--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=proS PE=3 SV=1 246 441 3.0E-21
sp|B8GPP4|SYP_THISH Proline--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=proS PE=3 SV=1 273 404 3.0E-21
sp|B0RDZ1|SYP_CLAMS Proline--tRNA ligase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=proS PE=3 SV=1 272 414 3.0E-21
sp|A5CX68|SYP_VESOH Proline--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=proS PE=3 SV=1 273 415 4.0E-21
sp|P39965|SYPM_YEAST Probable proline--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM10 PE=1 SV=1 267 406 5.0E-21
sp|A0QVM0|SYP_MYCS2 Proline--tRNA ligase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=proS PE=1 SV=1 239 439 5.0E-21
sp|C3PH25|SYP_CORA7 Proline--tRNA ligase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=proS PE=3 SV=1 273 408 5.0E-21
sp|Q9KYR6|SYP_STRCO Proline--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=proS PE=3 SV=1 267 404 6.0E-21
sp|B2GKS1|SYP_KOCRD Proline--tRNA ligase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=proS PE=3 SV=1 272 426 7.0E-21
sp|A5IJQ9|SYP_THEP1 Proline--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=proS PE=3 SV=1 275 408 8.0E-21
sp|A5FS84|SYP_DEHMB Proline--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=proS PE=3 SV=1 246 441 9.0E-21
sp|Q9WYY4|SYP_THEMA Proline--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=proS PE=3 SV=1 275 408 1.0E-20
sp|A6TL31|SYP_ALKMQ Proline--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=proS PE=3 SV=1 267 404 1.0E-20
sp|B1L8Y1|SYP_THESQ Proline--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=proS PE=3 SV=1 275 408 1.0E-20
sp|A1R508|SYP_ARTAT Proline--tRNA ligase OS=Arthrobacter aurescens (strain TC1) GN=proS PE=3 SV=1 239 408 1.0E-20
sp|A1T7H2|SYP_MYCVP Proline--tRNA ligase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=proS PE=3 SV=1 253 408 1.0E-20
sp|B9KGB1|SYP_CAMLR Proline--tRNA ligase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=proS PE=3 SV=1 267 438 1.0E-20
sp|B0RZJ0|SYP_FINM2 Proline--tRNA ligase OS=Finegoldia magna (strain ATCC 29328) GN=proS PE=3 SV=1 275 409 2.0E-20
sp|Q82K46|SYP1_STRAW Proline--tRNA ligase 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=proS1 PE=3 SV=1 267 404 2.0E-20
sp|B2FMR5|SYP_STRMK Proline--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=proS PE=3 SV=1 268 404 3.0E-20
sp|C5C9S6|SYP_MICLC Proline--tRNA ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=proS PE=3 SV=1 272 411 3.0E-20
sp|B1MD96|SYP_MYCA9 Proline--tRNA ligase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=proS PE=3 SV=1 253 438 4.0E-20
sp|A5CSZ7|SYP_CLAM3 Proline--tRNA ligase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=proS PE=3 SV=1 272 414 4.0E-20
sp|A0JUT1|SYP_ARTS2 Proline--tRNA ligase OS=Arthrobacter sp. (strain FB24) GN=proS PE=3 SV=1 260 440 9.0E-20
sp|A1SLL4|SYP_NOCSJ Proline--tRNA ligase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=proS PE=3 SV=1 246 439 1.0E-19
sp|B4SJ64|SYP_STRM5 Proline--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=proS PE=3 SV=1 268 404 1.0E-19
sp|B2S2A7|SYP_TREPS Proline--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=proS PE=3 SV=1 266 418 2.0E-19
sp|O83195|SYP_TREPA Proline--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=proS PE=3 SV=1 266 418 2.0E-19
sp|Q5FJN0|SYP_LACAC Proline--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=proS PE=3 SV=1 275 415 4.0E-19
sp|Q049U9|SYP_LACDB Proline--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=proS PE=3 SV=1 275 436 1.0E-18
sp|Q1G9P3|SYP_LACDA Proline--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=proS PE=3 SV=1 275 436 1.0E-18
sp|Q6AEX8|SYP_LEIXX Proline--tRNA ligase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=proS PE=3 SV=1 272 404 1.0E-18
sp|A0LV31|SYP_ACIC1 Proline--tRNA ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=proS PE=3 SV=1 245 404 2.0E-18
sp|Q9PG57|SYP_XYLFA Proline--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=proS PE=3 SV=2 268 404 5.0E-18
sp|Q044C3|SYP_LACGA Proline--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=proS PE=3 SV=1 275 415 7.0E-18
sp|Q87B25|SYP_XYLFT Proline--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=proS PE=3 SV=1 268 404 9.0E-18
sp|B2I7W6|SYP_XYLF2 Proline--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=proS PE=3 SV=1 268 404 9.0E-18
sp|Q74IS2|SYP_LACJO Proline--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=proS PE=3 SV=1 275 415 7.0E-17
sp|B0U4A7|SYP_XYLFM Proline--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=proS PE=3 SV=1 268 404 1.0E-16
sp|Q493B4|SYP_BLOPB Proline--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=proS PE=3 SV=1 271 403 2.0E-15
sp|Q1LSM8|SYP_BAUCH Proline--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=proS PE=3 SV=1 276 393 4.0E-15
sp|Q0S235|SYP1_RHOJR Proline--tRNA ligase 1 OS=Rhodococcus jostii (strain RHA1) GN=proS1 PE=3 SV=1 239 429 6.0E-14
sp|C1B2Z4|SYP_RHOOB Proline--tRNA ligase OS=Rhodococcus opacus (strain B4) GN=proS PE=3 SV=1 239 438 4.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1252
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4563 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5582
Ophiocordyceps camponoti-floridani Ophcf2|00121
Ophiocordyceps camponoti-rufipedis Ophun1|2290
Ophiocordyceps kimflemingae Ophio5|3821
Ophiocordyceps subramaniannii Hirsu2|10468

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4563
MPTAGIAATEGEDGHGKLIRAGFLRQAQSGIFQMLPLGLRVQQKVERLLDKRMQSIGASRLSLSTFSTEELWQKS
NRLHKVAPELFRLQDRKNTRLLLSPTHEEEMTALVASTVHSYKDLPVRLYQTTRKYRDEMRPRHGLLRSREFVMN
DLYTFDLCQEAAIDTYHHISAVYSAFFADLKLPVLVAEANAGHMGGNYSHEFHLSHSVGSDVVAVCRVCGHAVAY
EGAAAAAQQQGDEGQDGQAKGQDGQAKGQDDQAKGQDDQAKCRQCKTGSLRLERGLELAHTFYLGTRYSEPLDLC
VPVASGPDSPIHMGCYGIGVSRLIGAVAELKADHRGLHWPRLMAPFEVAMVPSSPQVPPEMLSLYDALAAQGLDV
VLDDRDKRFGWKMRDADLAGYPVVVVLGQAWRDDSMCEVQCSSLGINQTVASQALPAFVGKVISSL*
Coding >OphauG2|4563
ATGCCCACAGCCGGCATCGCTGCCACTGAAGGAGAGGATGGACATGGGAAGCTCATACGCGCGGGCTTCCTTCGG
CAGGCCCAGTCTGGCATCTTTCAAATGCTGCCCTTGGGCCTGCGAGTACAACAAAAGGTTGAGCGTCTGCTTGAT
AAACGCATGCAATCAATAGGGGCCTCACGGCTTTCACTCTCAACCTTTAGCACTGAAGAACTATGGCAAAAGAGT
AATCGACTGCACAAGGTGGCGCCAGAGCTCTTTCGGCTTCAAGACCGCAAAAACACGCGCCTCTTACTCTCTCCA
ACCCACGAGGAAGAGATGACGGCTCTGGTCGCCTCCACTGTCCACTCTTACAAGGACTTGCCCGTAAGGCTTTAC
CAAACAACTCGCAAATATCGCGACGAGATGCGCCCGCGCCACGGCCTGCTTCGCAGTCGCGAGTTCGTCATGAAT
GACCTCTATACTTTTGACCTCTGCCAAGAGGCGGCCATTGACACCTACCACCACATCTCAGCCGTCTACTCTGCC
TTTTTTGCCGACTTGAAGCTTCCTGTGCTGGTGGCCGAGGCCAATGCGGGACACATGGGCGGCAACTATAGCCAC
GAGTTCCATCTATCGCATTCAGTGGGCAGCGACGTGGTGGCGGTTTGTCGTGTATGTGGACACGCTGTGGCCTAT
GAGGGGGCGGCAGCAGCAGCTCAGCAGCAAGGCGACGAGGGCCAAGACGGCCAAGCCAAGGGCCAAGACGGCCAA
GCCAAGGGCCAAGACGACCAAGCCAAGGGCCAAGACGACCAAGCCAAGTGCCGCCAGTGCAAAACAGGCTCGCTG
CGCCTGGAGCGCGGCCTCGAACTCGCCCACACCTTTTACCTCGGCACCCGCTACTCAGAGCCCCTCGACCTCTGC
GTCCCCGTTGCCAGCGGCCCCGACTCGCCAATCCACATGGGCTGCTATGGCATCGGTGTCTCGCGCCTCATTGGC
GCCGTCGCAGAGCTCAAGGCCGACCACCGAGGCCTCCACTGGCCGCGCCTCATGGCCCCCTTTGAAGTCGCCATG
GTGCCCTCGTCGCCCCAAGTTCCCCCTGAGATGCTGAGCTTGTACGATGCCCTGGCTGCCCAGGGCCTCGATGTC
GTCCTTGATGATCGCGACAAGAGGTTTGGCTGGAAGATGCGCGACGCAGACTTGGCTGGCTATCCTGTTGTTGTT
GTTCTGGGCCAAGCCTGGCGCGACGATTCCATGTGTGAGGTTCAGTGCTCGTCTTTGGGCATTAACCAGACTGTG
GCTTCCCAGGCGCTGCCGGCGTTTGTTGGCAAAGTAATCTCAAGCCTTTGA
Transcript >OphauG2|4563
ATGCCCACAGCCGGCATCGCTGCCACTGAAGGAGAGGATGGACATGGGAAGCTCATACGCGCGGGCTTCCTTCGG
CAGGCCCAGTCTGGCATCTTTCAAATGCTGCCCTTGGGCCTGCGAGTACAACAAAAGGTTGAGCGTCTGCTTGAT
AAACGCATGCAATCAATAGGGGCCTCACGGCTTTCACTCTCAACCTTTAGCACTGAAGAACTATGGCAAAAGAGT
AATCGACTGCACAAGGTGGCGCCAGAGCTCTTTCGGCTTCAAGACCGCAAAAACACGCGCCTCTTACTCTCTCCA
ACCCACGAGGAAGAGATGACGGCTCTGGTCGCCTCCACTGTCCACTCTTACAAGGACTTGCCCGTAAGGCTTTAC
CAAACAACTCGCAAATATCGCGACGAGATGCGCCCGCGCCACGGCCTGCTTCGCAGTCGCGAGTTCGTCATGAAT
GACCTCTATACTTTTGACCTCTGCCAAGAGGCGGCCATTGACACCTACCACCACATCTCAGCCGTCTACTCTGCC
TTTTTTGCCGACTTGAAGCTTCCTGTGCTGGTGGCCGAGGCCAATGCGGGACACATGGGCGGCAACTATAGCCAC
GAGTTCCATCTATCGCATTCAGTGGGCAGCGACGTGGTGGCGGTTTGTCGTGTATGTGGACACGCTGTGGCCTAT
GAGGGGGCGGCAGCAGCAGCTCAGCAGCAAGGCGACGAGGGCCAAGACGGCCAAGCCAAGGGCCAAGACGGCCAA
GCCAAGGGCCAAGACGACCAAGCCAAGGGCCAAGACGACCAAGCCAAGTGCCGCCAGTGCAAAACAGGCTCGCTG
CGCCTGGAGCGCGGCCTCGAACTCGCCCACACCTTTTACCTCGGCACCCGCTACTCAGAGCCCCTCGACCTCTGC
GTCCCCGTTGCCAGCGGCCCCGACTCGCCAATCCACATGGGCTGCTATGGCATCGGTGTCTCGCGCCTCATTGGC
GCCGTCGCAGAGCTCAAGGCCGACCACCGAGGCCTCCACTGGCCGCGCCTCATGGCCCCCTTTGAAGTCGCCATG
GTGCCCTCGTCGCCCCAAGTTCCCCCTGAGATGCTGAGCTTGTACGATGCCCTGGCTGCCCAGGGCCTCGATGTC
GTCCTTGATGATCGCGACAAGAGGTTTGGCTGGAAGATGCGCGACGCAGACTTGGCTGGCTATCCTGTTGTTGTT
GTTCTGGGCCAAGCCTGGCGCGACGATTCCATGTGTGAGGTTCAGTGCTCGTCTTTGGGCATTAACCAGACTGTG
GCTTCCCAGGCGCTGCCGGCGTTTGTTGGCAAAGTAATCTCAAGCCTTTGA
Gene >OphauG2|4563
ATGCCCACAGCCGGCATCGCTGCCACTGAAGGAGAGGGTTAGTGGGAAGCAAAAAAAAAAAAAAAATTGAAATAA
AACATGACGCGACTAATGAGACACACAAGATGGACATGGGAAGCTCATACGCGCGGGCTTCCTTCGGCAGGTAAG
TGTTTTCTTTTCGGAACGAAACAGAATCGAGGCGACTGGGCTGATGGACCTTTTTTTTTTTCTTGATTTTCTATT
TGACCGCTTCAAGGCCCAGTCTGGCATCTTTCAAATGCTGCCCTTGGGCCTGCGAGTACAACAAAAGGTTGAGCG
TCTGCTTGATAAACGCATGCAATCAATAGGTATGCTGTTCACACACTTGTCCAACTCCAAGGCTGGATTCTGATT
TGCCATGTTGCAGGGGCCTCACGGCTTTCACTCTCAACCTTTAGCACTGAAGAACTATGGCAAAAGAGTAATCGA
CTGCACAAGGTGGCGCCAGAGGTAACAGGATCCATTTCCGGGCGACCAAGAAGAGGGCGCTCAAATTGCAGCAGC
TCTTTCGGCTTCAAGACCGCAAAAACACGCGCCTCTTACTCTCTCCAACCCACGAGGAAGAGATGACGGCTCTGG
TCGCCTCCACTGTCCACTCTTACAAGGACTTGCCCGTAAGGCTTTACCAAACAAGTCAGTGTCAGTGGCGTGCGA
GTAGATGCCCTGTGCTCACCATGTGCTTGCTACAGCTCGCAAATATCGCGACGAGATGCGCCCGCGCCACGGCCT
GCTTCGCAGTCGCGAGTTCGTCATGAATGACCTCTATACTTTTGACCTCTGCCAAGAGGCGGCCATTGACACCTA
CCACCACATCTCAGCCGTCTACTCTGCCTTTTTTGCCGACTTGAAGCTTCCTGTGCTGGTGGCCGAGGCCAATGC
GGGACACATGGGCGGCAACTATAGCCACGAGTTCCATCTATCGCATTCAGTGGGCAGCGACGTGGTGGCGGTTTG
TCGTGTATGTGGACACGCTGTGGCCTATGAGGGGGCGGCAGCAGCAGCTCAGCAGCAAGGCGACGAGGGCCAAGA
CGGCCAAGCCAAGGGCCAAGACGGCCAAGCCAAGGGCCAAGACGACCAAGCCAAGGGCCAAGACGACCAAGCCAA
GTGCCGCCAGTGCAAAACAGGCTCGCTGCGCCTGGAGCGCGGCCTCGAACTCGCCCACACCTTTTACCTCGGCAC
CCGCTACTCAGAGCCCCTCGACCTCTGCGTCCCCGTTGCCAGCGGCCCCGACTCGCCAATCCACATGGGCTGCTA
TGGCATCGGTGTCTCGCGCCTCATTGGCGCCGTCGCAGAGCTCAAGGCCGACCACCGAGGCCTCCACTGGCCGCG
CCTCATGGCCCCCTTTGAAGTCGCCATGGTGCCCTCGTCGCCCCAAGTTCCCCCTGAGATGCTGAGCTTGTACGA
TGCCCTGGCTGCCCAGGGCCTCGATGTCGTCCTTGATGATCGCGACAAGAGGTTTGGCTGGAAGATGCGCGACGC
AGACTTGGCTGGCTATCCTGTTGTTGTTGTTCTGGGCCAAGCCTGGCGCGACGATTCCATGTGTGAGGTTCAGTG
CTCGTCTTTGGGCATTAACCAGACTGTGGCTTCCCAGGCGCTGCCGGCGTTTGTTGGCAAAGTAATCTCAAGCCT
TTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail