Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|455
Gene name
LocationContig_110:9648..10551
Strand-
Gene length (bp)903
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.854371

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|455 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|264
Ophiocordyceps australis map64 (Brazil) OphauB2|7295
Ophiocordyceps camponoti-rufipedis Ophun1|2525
Ophiocordyceps kimflemingae Ophio5|7787
Ophiocordyceps subramaniannii Hirsu2|3556

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|455
MKISAVLLPIGVATAFPMPFKGLFERALPSTEPTAAERFLRDFAPIPGINIATGAFGGAASGAAGGIRSLLRGGG
IRGGATRGGLPARVASSSKPGGVPPKVPGGGSSFTEFESIVPNREVQGIPPKGAPAGGNARAPDLGPSRGIKGLP
PKGGSANANAGAQGATAFGPSRGILGLPPKGAPPRGGVPGRGGASAEARKPFKPFPKVNGVEINPETNKPLRFQG
QNPQGSAPKSNGRGGLSNGKGLPGGGSIQANINAGAQGKNVAPGGGLVPRPRM*
Coding >OphauG2|455
ATGAAGATCTCGGCAGTTCTTCTCCCCATTGGTGTGGCCACCGCTTTTCCAATGCCCTTTAAAGGGCTGTTTGAG
CGCGCATTGCCCTCTACTGAGCCCACTGCTGCAGAGCGCTTTTTGCGCGACTTTGCGCCTATTCCTGGCATCAAC
ATAGCCACTGGTGCCTTTGGAGGTGCTGCCAGCGGAGCTGCTGGTGGCATTCGCTCCCTTCTTCGCGGCGGCGGT
ATTCGTGGCGGCGCTACTCGCGGCGGTCTTCCCGCCCGTGTTGCCTCCTCCTCCAAGCCAGGCGGCGTGCCTCCC
AAGGTCCCAGGCGGTGGCTCGTCCTTTACTGAATTCGAATCCATCGTGCCTAATAGAGAAGTCCAGGGCATTCCT
CCCAAGGGAGCTCCCGCTGGAGGCAACGCCCGAGCCCCTGACCTGGGCCCCAGCCGCGGAATCAAGGGCCTGCCC
CCCAAGGGCGGTTCAGCCAACGCCAACGCCGGTGCTCAGGGCGCAACGGCTTTTGGCCCCAGCCGAGGAATCCTG
GGCCTGCCCCCCAAGGGCGCTCCTCCCCGAGGCGGTGTTCCCGGCAGAGGCGGTGCCAGCGCCGAGGCCAGGAAG
CCCTTCAAGCCGTTCCCCAAGGTCAACGGAGTCGAGATCAACCCCGAAACCAACAAGCCTCTCCGCTTCCAAGGC
CAGAATCCCCAAGGCTCGGCTCCCAAGTCCAACGGCAGGGGCGGCCTTTCCAATGGCAAGGGGCTTCCCGGCGGA
GGATCTATTCAGGCCAATATCAATGCTGGCGCACAGGGCAAAAACGTTGCGCCTGGTGGTGGCCTTGTGCCCCGT
CCTAGGATGTAG
Transcript >OphauG2|455
ATGAAGATCTCGGCAGTTCTTCTCCCCATTGGTGTGGCCACCGCTTTTCCAATGCCCTTTAAAGGGCTGTTTGAG
CGCGCATTGCCCTCTACTGAGCCCACTGCTGCAGAGCGCTTTTTGCGCGACTTTGCGCCTATTCCTGGCATCAAC
ATAGCCACTGGTGCCTTTGGAGGTGCTGCCAGCGGAGCTGCTGGTGGCATTCGCTCCCTTCTTCGCGGCGGCGGT
ATTCGTGGCGGCGCTACTCGCGGCGGTCTTCCCGCCCGTGTTGCCTCCTCCTCCAAGCCAGGCGGCGTGCCTCCC
AAGGTCCCAGGCGGTGGCTCGTCCTTTACTGAATTCGAATCCATCGTGCCTAATAGAGAAGTCCAGGGCATTCCT
CCCAAGGGAGCTCCCGCTGGAGGCAACGCCCGAGCCCCTGACCTGGGCCCCAGCCGCGGAATCAAGGGCCTGCCC
CCCAAGGGCGGTTCAGCCAACGCCAACGCCGGTGCTCAGGGCGCAACGGCTTTTGGCCCCAGCCGAGGAATCCTG
GGCCTGCCCCCCAAGGGCGCTCCTCCCCGAGGCGGTGTTCCCGGCAGAGGCGGTGCCAGCGCCGAGGCCAGGAAG
CCCTTCAAGCCGTTCCCCAAGGTCAACGGAGTCGAGATCAACCCCGAAACCAACAAGCCTCTCCGCTTCCAAGGC
CAGAATCCCCAAGGCTCGGCTCCCAAGTCCAACGGCAGGGGCGGCCTTTCCAATGGCAAGGGGCTTCCCGGCGGA
GGATCTATTCAGGCCAATATCAATGCTGGCGCACAGGGCAAAAACGTTGCGCCTGGTGGTGGCCTTGTGCCCCGT
CCTAGGATGTAG
Gene >OphauG2|455
ATGAAGATCTCGGCAGTTCTTCTCCCCATTGGTGTGGCCACCGCTTTTCCAATGCCCTTTAAAGGGCTGTTTGAG
CGCGCATTGCCCTCTACTGAGCCCACTGCTGCAGAGCGCTTTTTGCGCGACTTTGCGGTAAGCAAAGCCTGCATC
CAAGCGTGATCCAGCATTATACTAACATGAAAACCATGCTCCTTGCAGCCTATTCCTGGCATCAACATAGCCACT
GGTGCCTTTGGAGGTGCTGCCAGCGGAGCTGCTGGTGGCATTCGCTCCCTTCTTCGCGGCGGCGGTATTCGTGGC
GGCGCTACTCGCGGCGGTCTTCCCGCCCGTGTTGCCTCCTCCTCCAAGCCAGGCGGCGTGCCTCCCAAGGTCCCA
GGCGGTGGCTCGTCCTTTACTGAATTCGAATCCATCGTGCCTAATAGAGAAGTCCAGGGCATTCCTCCCAAGGGA
GCTCCCGCTGGAGGCAACGCCCGAGCCCCTGACCTGGGCCCCAGCCGCGGAATCAAGGGCCTGCCCCCCAAGGGC
GGTTCAGCCAACGCCAACGCCGGTGCTCAGGGCGCAACGGCTTTTGGCCCCAGCCGAGGAATCCTGGGCCTGCCC
CCCAAGGGCGCTCCTCCCCGAGGCGGTGTTCCCGGCAGAGGCGGTGCCAGCGCCGAGGCCAGGAAGCCCTTCAAG
CCGTTCCCCAAGGTCAACGGAGTCGAGATCAACCCCGAAACCAACAAGCCTCTCCGCTTCCAAGGCCAGAATCCC
CAAGGCTCGGCTCCCAAGTCCAACGGCAGGGGCGGCCTTTCCAATGGCAAGGGGCTTCCCGGCGGAGGATCTATT
CAGGCCAATATCAATGCTGGCGCACAGGGCAAAAACGTTGCGCCTGGTGGTGGCCTTGTGCCCCGTCCTAGGATG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail