Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4546
Gene name
LocationContig_385:6970..10621
Strand-
Gene length (bp)3651
Transcript length (bp)3333
Coding sequence length (bp)3333
Protein length (aa) 1111

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01412 ArfGap Putative GTPase activating protein for Arf 1.9E-31 833 946
PF16746 BAR_3 BAR domain of APPL family 1.3E-21 301 531
PF00169 PH PH domain 4.9E-11 658 745

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 643 982 2.0E-59
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 21 523 6.0E-56
sp|Q10165|CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnt6 PE=1 SV=1 643 982 4.0E-55
sp|Q15027|ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ACAP1 PE=1 SV=1 655 950 2.0E-41
sp|A5PK26|ACAP1_BOVIN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ACAP1 PE=2 SV=1 655 950 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 643 982 2.0E-59
sp|Q9UUE2|CSX2_SCHPO Protein csx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=csx2 PE=1 SV=1 21 523 6.0E-56
sp|Q10165|CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnt6 PE=1 SV=1 643 982 4.0E-55
sp|Q15027|ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ACAP1 PE=1 SV=1 655 950 2.0E-41
sp|A5PK26|ACAP1_BOVIN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ACAP1 PE=2 SV=1 655 950 2.0E-40
sp|Q8K2H4|ACAP1_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Acap1 PE=1 SV=1 655 950 4.0E-38
sp|Q5ZK62|ACAP2_CHICK Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Gallus gallus GN=ACAP2 PE=2 SV=1 655 955 2.0E-36
sp|Q5FVC7|ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Acap2 PE=1 SV=1 655 946 5.0E-33
sp|Q6ZQK5|ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Acap2 PE=1 SV=2 655 946 1.0E-32
sp|Q6IVG4|ACAP2_RABIT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Oryctolagus cuniculus GN=ACAP2 PE=2 SV=1 655 946 2.0E-32
sp|Q15057|ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ACAP2 PE=1 SV=3 655 946 7.0E-32
sp|Q96P50|ACAP3_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ACAP3 PE=1 SV=2 655 1017 4.0E-31
sp|Q96P47|AGAP3_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=AGAP3 PE=1 SV=2 825 976 9.0E-26
sp|Q8VHH5|AGAP3_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Agap3 PE=1 SV=1 825 976 1.0E-25
sp|Q9FIT8|AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana GN=AGD1 PE=2 SV=2 696 946 2.0E-25
sp|Q5W7F2|AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana GN=AGD3 PE=1 SV=1 696 946 2.0E-24
sp|Q9NGC3|CEG1A_DROME Centaurin-gamma-1A OS=Drosophila melanogaster GN=CenG1A PE=2 SV=2 835 1041 2.0E-24
sp|Q04412|AGE1_YEAST ADP-ribosylation factor GTPase-activating protein effector protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGE1 PE=1 SV=1 827 946 3.0E-24
sp|Q8BXK8|AGAP1_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Agap1 PE=1 SV=1 832 959 8.0E-24
sp|Q9UPQ3|AGAP1_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=AGAP1 PE=1 SV=4 832 963 1.0E-23
sp|Q6NRL1|AGAP1_XENLA Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1 OS=Xenopus laevis GN=agap1 PE=2 SV=1 832 959 2.0E-23
sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 689 982 2.0E-23
sp|Q99490|AGAP2_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=AGAP2 PE=1 SV=2 832 976 3.0E-23
sp|Q8CGU4|AGAP2_RAT Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus GN=Agap2 PE=1 SV=1 832 959 5.0E-23
sp|Q3UHD9|AGAP2_MOUSE Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Agap2 PE=1 SV=1 832 959 6.0E-23
sp|Q96P64|AGAP4_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4 OS=Homo sapiens GN=AGAP4 PE=2 SV=2 840 963 7.0E-23
sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 691 946 1.0E-22
sp|Q5VUJ5|AGAP7_HUMAN Putative Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 7 OS=Homo sapiens GN=AGAP7P PE=5 SV=1 840 963 1.0E-22
sp|Q5VW22|AGAP6_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 OS=Homo sapiens GN=AGAP6 PE=2 SV=1 840 963 5.0E-22
sp|Q10165|CNT6_SCHPO Probable ribosylation factor GTPase-activating protein cnt6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnt6 PE=1 SV=1 172 539 6.0E-22
sp|Q8TF27|AGA11_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 11 OS=Homo sapiens GN=AGAP11 PE=2 SV=2 840 963 6.0E-22
sp|Q5VTM2|AGAP9_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 9 OS=Homo sapiens GN=AGAP9 PE=3 SV=2 840 976 8.0E-22
sp|A6NIR3|AGAP5_HUMAN Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 5 OS=Homo sapiens GN=AGAP5 PE=2 SV=2 840 963 2.0E-21
sp|A8MT82|CTLFB_HUMAN Putative centaurin-gamma-like family member 11P OS=Homo sapiens GN=CTGLF11P PE=5 SV=2 840 963 3.0E-21
sp|Q8LFN9|AGD13_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD13 OS=Arabidopsis thaliana GN=AGD13 PE=2 SV=1 845 948 5.0E-20
sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD11 OS=Arabidopsis thaliana GN=AGD11 PE=2 SV=1 813 951 6.0E-20
sp|Q9FVJ3|AGD12_ARATH ADP-ribosylation factor GTPase-activating protein AGD12 OS=Arabidopsis thaliana GN=AGD12 PE=1 SV=1 845 948 1.0E-19
sp|Q8WZ64|ARAP2_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ARAP2 PE=1 SV=3 664 977 2.0E-19
sp|Q8BZ05|ARAP2_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Arap2 PE=1 SV=2 664 977 5.0E-19
sp|O43150|ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ASAP2 PE=1 SV=3 841 976 1.0E-18
sp|Q7SIG6|ASAP2_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Asap2 PE=1 SV=3 841 1004 1.0E-18
sp|Q8WWN8|ARAP3_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ARAP3 PE=1 SV=1 838 950 1.0E-17
sp|Q0WQQ1|AGD15_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD15 OS=Arabidopsis thaliana GN=AGD15 PE=2 SV=1 845 948 7.0E-17
sp|Q9FL69|AGD5_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD5 OS=Arabidopsis thaliana GN=AGD5 PE=1 SV=1 845 946 7.0E-17
sp|Q8TDY4|ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens GN=ASAP3 PE=1 SV=1 695 976 8.0E-17
sp|Q9UT34|YIQ9_SCHPO Uncharacterized protein C824.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.09c PE=3 SV=1 845 946 1.0E-16
sp|Q4LDD4|ARAP1_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Arap1 PE=1 SV=2 667 1007 2.0E-16
sp|O97902|ASAP1_BOVIN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Bos taurus GN=ASAP1 PE=1 SV=1 841 1055 6.0E-16
sp|Q1AAU6|ASAP1_RAT Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Rattus norvegicus GN=Asap1 PE=1 SV=2 841 976 6.0E-16
sp|Q9QWY8|ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus GN=Asap1 PE=1 SV=2 841 976 6.0E-16
sp|Q9ULH1|ASAP1_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ASAP1 PE=1 SV=4 841 1055 7.0E-16
sp|Q8R5G7|ARAP3_MOUSE Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Arap3 PE=1 SV=3 845 950 8.0E-16
sp|Q5U464|ASAP3_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Mus musculus GN=Asap3 PE=2 SV=1 695 945 8.0E-16
sp|Q96P48|ARAP1_HUMAN Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens GN=ARAP1 PE=1 SV=3 842 968 2.0E-15
sp|O74345|UCP3_SCHPO UBA domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp3 PE=3 SV=1 830 946 2.0E-15
sp|P40529|AGE2_YEAST ADP-ribosylation factor GTPase-activating protein effector protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AGE2 PE=1 SV=1 839 949 5.0E-15
sp|Q7TN29|SMAP2_MOUSE Stromal membrane-associated protein 2 OS=Mus musculus GN=Smap2 PE=1 SV=1 839 945 6.0E-14
sp|Q8WU79|SMAP2_HUMAN Stromal membrane-associated protein 2 OS=Homo sapiens GN=SMAP2 PE=1 SV=1 839 945 8.0E-14
sp|Q5EA00|SMAP2_BOVIN Stromal membrane-associated protein 2 OS=Bos taurus GN=SMAP2 PE=2 SV=1 839 945 3.0E-13
sp|Q5F413|SMAP2_CHICK Stromal membrane-associated protein 2 OS=Gallus gallus GN=SMAP2 PE=2 SV=1 838 945 7.0E-13
sp|Q9NPF8|ADAP2_HUMAN Arf-GAP with dual PH domain-containing protein 2 OS=Homo sapiens GN=ADAP2 PE=1 SV=1 827 951 2.0E-12
sp|Q8IYB5|SMAP1_HUMAN Stromal membrane-associated protein 1 OS=Homo sapiens GN=SMAP1 PE=1 SV=2 831 917 3.0E-12
sp|Q91VZ6|SMAP1_MOUSE Stromal membrane-associated protein 1 OS=Mus musculus GN=Smap1 PE=1 SV=1 831 917 3.0E-12
sp|Q9JK15|ADAP2_RAT Arf-GAP with dual PH domain-containing protein 2 OS=Rattus norvegicus GN=Adap2 PE=1 SV=1 827 946 4.0E-11
sp|Q14161|GIT2_HUMAN ARF GTPase-activating protein GIT2 OS=Homo sapiens GN=GIT2 PE=1 SV=2 845 999 4.0E-11
sp|Q9JLQ2|GIT2_MOUSE ARF GTPase-activating protein GIT2 OS=Mus musculus GN=Git2 PE=1 SV=2 845 999 6.0E-11
sp|Q8R2V5|ADAP2_MOUSE Arf-GAP with dual PH domain-containing protein 2 OS=Mus musculus GN=Adap2 PE=1 SV=1 827 945 1.0E-10
sp|Q9EPJ9|ARFG1_MOUSE ADP-ribosylation factor GTPase-activating protein 1 OS=Mus musculus GN=Arfgap1 PE=1 SV=2 830 889 3.0E-10
sp|Q62848|ARFG1_RAT ADP-ribosylation factor GTPase-activating protein 1 OS=Rattus norvegicus GN=Arfgap1 PE=1 SV=1 830 889 3.0E-10
sp|Q9Y2X7|GIT1_HUMAN ARF GTPase-activating protein GIT1 OS=Homo sapiens GN=GIT1 PE=1 SV=2 845 1005 3.0E-10
sp|Q68FF6|GIT1_MOUSE ARF GTPase-activating protein GIT1 OS=Mus musculus GN=Git1 PE=1 SV=1 845 1005 4.0E-10
sp|Q8N6T3|ARFG1_HUMAN ADP-ribosylation factor GTPase-activating protein 1 OS=Homo sapiens GN=ARFGAP1 PE=1 SV=2 830 889 4.0E-10
sp|Q9Z272|GIT1_RAT ARF GTPase-activating protein GIT1 OS=Rattus norvegicus GN=Git1 PE=1 SV=1 845 1005 4.0E-10
sp|O75689|ADAP1_HUMAN Arf-GAP with dual PH domain-containing protein 1 OS=Homo sapiens GN=ADAP1 PE=1 SV=2 841 948 9.0E-10
sp|O82171|AGD10_ARATH ADP-ribosylation factor GTPase-activating protein AGD10 OS=Arabidopsis thaliana GN=AGD10 PE=2 SV=1 820 914 2.0E-09
sp|Q99K28|ARFG2_MOUSE ADP-ribosylation factor GTPase-activating protein 2 OS=Mus musculus GN=Arfgap2 PE=1 SV=1 842 889 3.0E-09
sp|Q3MID3|ARFG2_RAT ADP-ribosylation factor GTPase-activating protein 2 OS=Rattus norvegicus GN=Arfgap2 PE=1 SV=1 842 889 3.0E-09
sp|Q9FIQ0|AGD9_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD9 OS=Arabidopsis thaliana GN=AGD9 PE=1 SV=1 842 914 4.0E-09
sp|P38682|GLO3_YEAST ADP-ribosylation factor GTPase-activating protein GLO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO3 PE=1 SV=1 842 906 5.0E-09
sp|O80925|AGD7_ARATH ADP-ribosylation factor GTPase-activating protein AGD7 OS=Arabidopsis thaliana GN=AGD7 PE=1 SV=1 845 912 6.0E-09
sp|A1L520|ARFG2_BOVIN ADP-ribosylation factor GTPase-activating protein 2 OS=Bos taurus GN=ARFGAP2 PE=2 SV=1 842 889 7.0E-09
sp|Q8N6H7|ARFG2_HUMAN ADP-ribosylation factor GTPase-activating protein 2 OS=Homo sapiens GN=ARFGAP2 PE=1 SV=1 842 889 7.0E-09
sp|P35197|GCS1_YEAST ADP-ribosylation factor GTPase-activating protein GCS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCS1 PE=1 SV=1 822 889 9.0E-09
sp|Q5RAT7|ARFG2_PONAB ADP-ribosylation factor GTPase-activating protein 2 OS=Pongo abelii GN=ARFGAP2 PE=2 SV=1 845 889 9.0E-09
sp|Q10367|GLO3_SCHPO ADP-ribosylation factor GTPase-activating protein glo3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=glo3 PE=3 SV=2 830 970 1.0E-08
sp|Q9M354|AGD6_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD6 OS=Arabidopsis thaliana GN=AGD6 PE=1 SV=1 845 889 1.0E-08
sp|Q28CM8|ARFG2_XENTR ADP-ribosylation factor GTPase-activating protein 2 OS=Xenopus tropicalis GN=arfgap2 PE=2 SV=1 845 889 1.0E-08
sp|Q09531|YQP4_CAEEL Uncharacterized protein F07F6.4 OS=Caenorhabditis elegans GN=F07F6.4 PE=3 SV=2 842 915 2.0E-08
sp|Q8H100|AGD8_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD8 OS=Arabidopsis thaliana GN=AGD8 PE=1 SV=1 842 914 3.0E-08
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 845 941 4.0E-08
sp|Q9D8S3|ARFG3_MOUSE ADP-ribosylation factor GTPase-activating protein 3 OS=Mus musculus GN=Arfgap3 PE=1 SV=2 842 889 4.0E-08
sp|Q4KLN7|ARFG3_RAT ADP-ribosylation factor GTPase-activating protein 3 OS=Rattus norvegicus GN=Arfgap3 PE=1 SV=1 845 889 4.0E-08
sp|Q17R07|ARFG3_BOVIN ADP-ribosylation factor GTPase-activating protein 3 OS=Bos taurus GN=ARFGAP3 PE=2 SV=1 845 889 4.0E-08
sp|Q4R4C9|ARFG3_MACFA ADP-ribosylation factor GTPase-activating protein 3 OS=Macaca fascicularis GN=ARFGAP3 PE=2 SV=1 845 889 5.0E-08
sp|Q5R787|ARFG3_PONAB ADP-ribosylation factor GTPase-activating protein 3 OS=Pongo abelii GN=ARFGAP3 PE=2 SV=1 845 889 5.0E-08
sp|Q9NP61|ARFG3_HUMAN ADP-ribosylation factor GTPase-activating protein 3 OS=Homo sapiens GN=ARFGAP3 PE=1 SV=1 845 889 6.0E-08
sp|Q9C6C3|AGD2_ARATH ADP-ribosylation factor GTPase-activating protein AGD2 OS=Arabidopsis thaliana GN=AGD2 PE=2 SV=1 301 515 9.0E-07
sp|Q9SMX5|AGD4_ARATH ADP-ribosylation factor GTPase-activating protein AGD4 OS=Arabidopsis thaliana GN=AGD4 PE=2 SV=2 301 567 1.0E-06
sp|O43150|ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens GN=ASAP2 PE=1 SV=3 371 539 3.0E-06
sp|Q7SIG6|ASAP2_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Mus musculus GN=Asap2 PE=1 SV=3 307 539 3.0E-06
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 302 548 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005096 GTPase activator activity Yes
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0008047 enzyme activator activity No
GO:0098772 molecular function regulator activity No
GO:0030695 GTPase regulator activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3451
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4546 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1707
Ophiocordyceps camponoti-floridani Ophcf2|07152
Ophiocordyceps camponoti-rufipedis Ophun1|3332
Ophiocordyceps kimflemingae Ophio5|2285
Ophiocordyceps subramaniannii Hirsu2|6577

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4546
MGNVSSRLEDAPTLYLRDQSRLTITSLVVTSPRKRSSLNIVPNAFPASRLLVSRPAGETAPVEYIQDPEASNNPS
GMPAILLKLSSDDELIFTFTFVLRQAQQAPPPSSHDAHLARDTNISGLTYVCASTTREVDNLVTREFHADPNLHK
NANVDLVGDYSTNGKSSVSFEWTWKWKPPKTLEDKGGGWRNSCSFVEYDSRAHRLITLASFSYWVSSGTSPLSHP
SSPSPPFLLAPPPKIRIASTQSVDSRLTRGAEPEEPTSPLLLPVDSNVGAVTPQTKESFKVDVSCPRPGDDATIS
DDGPVFRATLKALEQKTGNMRTHMKRVLKKAEQAQIAQGDANEAFNAFVDALREASATNANAVQPALDHYFDKIA
RAIFDYEKQSTANLQRIIIEPLSRLYQVDIKGAESKKREFDEESKDYYSYVSRYLGQRQDSVKAKKLAESDSKYQ
HKRRNFELKRFDYSNFVQDLHGGRKEQEVLSHLTKYASAQTRGYLATANKVEGLLPQLEALTAEVHVADKEYQYR
RREREEKRRVLETGNTLYNEPEQSSVSNAVPQASNSNGNGGSASDSELGRADSTGSQVRNAIAIGGAQPSTGYGV
ELSRSPGSLAQPTMGTPVQATKFKGFRDLEERESGQGTVGERKEGLLWALNRPGGHVDPRALNKQAWHKFWIVLD
QGKLSEYSNWKQRLDLHMDPIDLRMASVREARTAERRFCFEVITPSFKRVYQATSEEDMNSWIVSINNALQSAME
GRALQDCSGAAKRPAESSMQRDIGSVLTGKTHSLGHGSSPYYYQHASQGGSGLPLRRTTVGARPSAVRTASSGYN
DNPDQLLQMVRTADQGNCWCADCGSGSKVEWVSINLGIVLCIECSGIHRSLGTHISKVRSLTLDIKSFTIDIVEV
LLLIGNRVSNMIWEARLEPVKKPGPLASREQRLKFITAKYVERAFVGPLPGQATAEEALLLGIKKNEIQGVLHAL
ALRANPNATDKMRGTHAVWLALAAVDPASPSPSPAPGVGSSDADHKTTPFAVAELLMQNGADIAATLPPFPLGKL
AQQYCEQKQGRGNKAPASDGLSSLPQTINASDKLQREREARLQKRVSAGGRLAKSPIPEK*
Coding >OphauG2|4546
ATGGGCAACGTGAGCAGCCGGCTCGAAGACGCGCCGACTCTGTATCTCAGAGACCAGAGCCGCTTAACAATCACG
TCTCTTGTCGTCACGAGTCCGCGCAAACGCAGCTCCCTCAACATTGTTCCAAATGCATTTCCAGCCAGCAGGCTG
CTTGTCTCCCGGCCTGCCGGCGAGACGGCCCCTGTAGAATACATTCAGGACCCCGAAGCCTCCAATAACCCCAGT
GGCATGCCAGCTATTCTCCTCAAACTCAGCAGCGATGATGAACTTATCTTTACCTTTACATTTGTTTTGCGCCAG
GCGCAGCAAGCCCCACCACCGTCCAGCCATGACGCCCACCTTGCTCGCGACACAAATATCTCGGGCCTCACTTAT
GTCTGTGCTTCGACTACTCGCGAGGTCGACAATCTAGTCACCCGCGAGTTTCATGCCGACCCCAACCTGCACAAA
AACGCAAACGTAGACCTCGTCGGCGACTACAGCACCAACGGTAAATCCTCGGTATCATTCGAGTGGACGTGGAAG
TGGAAGCCGCCCAAGACGCTCGAAGACAAGGGTGGCGGTTGGAGGAACTCGTGCAGTTTTGTTGAGTATGATTCT
CGCGCCCATCGCCTTATTACCCTCGCCAGCTTTTCTTACTGGGTCTCGAGCGGCACCTCGCCCCTGAGCCATCCC
AGCTCGCCTTCACCGCCCTTTCTCCTGGCTCCTCCCCCCAAAATTCGCATTGCTTCGACGCAATCAGTCGACTCG
CGACTCACTAGAGGCGCTGAACCCGAGGAGCCTACATCTCCCTTGTTGCTACCAGTTGACTCTAATGTTGGGGCT
GTGACGCCACAGACCAAGGAGTCTTTCAAAGTTGACGTCTCATGTCCTCGACCTGGCGATGATGCCACTATATCT
GATGATGGCCCCGTGTTTCGGGCCACCCTCAAGGCTTTGGAGCAAAAAACGGGCAATATGCGCACACATATGAAG
AGAGTACTCAAAAAAGCAGAACAGGCTCAAATTGCTCAAGGCGATGCCAACGAGGCCTTCAATGCTTTTGTGGAT
GCTCTGCGTGAGGCCTCGGCCACCAATGCTAACGCTGTCCAGCCGGCTTTGGACCACTACTTTGACAAGATAGCC
CGCGCCATCTTCGACTATGAAAAGCAAAGCACGGCAAATTTACAAAGAATCATAATCGAGCCGCTCAGCAGGCTT
TATCAGGTCGACATCAAGGGAGCCGAGTCCAAGAAGAGAGAGTTTGACGAGGAGAGCAAAGACTATTATTCCTAC
GTGTCTCGGTATCTTGGCCAACGTCAAGATTCAGTAAAGGCCAAGAAGCTTGCCGAGAGTGACTCAAAGTACCAG
CACAAGCGACGCAATTTCGAGCTCAAACGTTTTGATTATTCTAATTTCGTGCAGGATCTTCATGGAGGCCGCAAG
GAACAAGAAGTCTTGTCGCACCTAACCAAGTATGCATCGGCGCAAACAAGGGGCTATCTAGCTACAGCCAACAAG
GTTGAGGGACTCTTGCCGCAGCTGGAAGCCCTCACGGCCGAGGTTCACGTGGCCGATAAAGAGTATCAATATCGC
CGTCGTGAGCGTGAGGAGAAGAGGCGCGTTCTTGAAACAGGCAACACGCTGTACAATGAGCCCGAGCAATCCAGT
GTCAGCAACGCCGTGCCTCAAGCCTCAAACTCGAATGGCAACGGCGGCAGCGCTTCTGACTCGGAGCTGGGGCGA
GCCGATAGCACCGGGTCCCAGGTCAGGAATGCCATCGCCATTGGAGGGGCTCAGCCCAGCACCGGCTACGGCGTG
GAGCTATCGAGATCTCCTGGCAGTCTTGCCCAGCCAACCATGGGTACCCCTGTGCAAGCGACCAAGTTTAAAGGG
TTTCGTGATTTGGAGGAGCGCGAATCGGGCCAGGGCACTGTTGGTGAGCGGAAAGAGGGTCTGCTGTGGGCTCTC
AACCGGCCTGGAGGGCACGTGGACCCACGGGCCTTAAACAAACAAGCATGGCACAAGTTCTGGATTGTGCTTGAT
CAGGGAAAGCTGTCCGAGTATAGCAACTGGAAGCAGAGGCTCGACCTGCACATGGATCCCATAGACCTTCGCATG
GCATCTGTGCGCGAAGCTCGAACCGCCGAGCGACGTTTTTGCTTCGAGGTGATTACACCAAGCTTCAAGCGCGTC
TACCAGGCAACATCGGAGGAAGATATGAATAGCTGGATCGTATCCATTAACAATGCACTGCAGAGCGCCATGGAG
GGCCGGGCCCTCCAAGATTGCTCCGGCGCGGCCAAGAGGCCTGCTGAATCTTCCATGCAGAGAGACATTGGATCC
GTACTGACGGGAAAGACGCATTCGCTGGGCCACGGCTCGTCCCCGTACTACTACCAGCATGCGAGTCAGGGCGGC
AGCGGGCTTCCTCTGCGCAGAACAACGGTTGGCGCAAGGCCGAGCGCAGTGCGAACGGCCAGCTCGGGCTACAAT
GACAACCCGGACCAACTGCTGCAGATGGTTCGCACTGCTGACCAAGGCAACTGCTGGTGTGCAGACTGTGGCTCT
GGGTCCAAGGTTGAGTGGGTATCCATCAACCTGGGCATTGTCCTCTGCATCGAATGCAGTGGCATTCATCGGTCG
CTGGGGACGCACATCAGCAAAGTGCGGTCGCTGACGCTAGACATCAAGTCTTTTACCATCGATATTGTCGAAGTG
CTCCTCCTGATTGGAAACAGGGTGTCAAACATGATTTGGGAGGCCAGACTGGAACCAGTCAAGAAGCCCGGACCG
TTGGCGTCTCGAGAACAGCGCTTGAAATTCATTACGGCCAAGTATGTGGAGCGGGCCTTTGTCGGACCGCTGCCA
GGCCAGGCAACGGCAGAAGAGGCCTTGCTACTCGGAATCAAGAAGAACGAGATACAAGGAGTCTTGCATGCGCTG
GCGCTCAGGGCAAACCCCAATGCCACGGACAAGATGAGGGGCACTCACGCGGTTTGGCTTGCCCTGGCGGCCGTC
GATCCCGCGTCACCCTCGCCCTCGCCGGCGCCTGGTGTAGGTTCGTCGGATGCAGACCACAAGACGACGCCGTTT
GCCGTGGCCGAACTGCTCATGCAGAACGGCGCCGACATTGCGGCTACTTTACCGCCCTTCCCCTTGGGCAAATTG
GCTCAGCAGTACTGTGAGCAGAAACAGGGTCGAGGCAACAAGGCTCCTGCTAGCGATGGGCTGTCATCACTACCG
CAGACGATAAACGCGAGCGACAAGCTCCAGCGCGAACGAGAGGCTCGGCTGCAGAAGCGAGTAAGCGCAGGCGGG
AGATTGGCCAAGTCGCCCATTCCCGAGAAATAG
Transcript >OphauG2|4546
ATGGGCAACGTGAGCAGCCGGCTCGAAGACGCGCCGACTCTGTATCTCAGAGACCAGAGCCGCTTAACAATCACG
TCTCTTGTCGTCACGAGTCCGCGCAAACGCAGCTCCCTCAACATTGTTCCAAATGCATTTCCAGCCAGCAGGCTG
CTTGTCTCCCGGCCTGCCGGCGAGACGGCCCCTGTAGAATACATTCAGGACCCCGAAGCCTCCAATAACCCCAGT
GGCATGCCAGCTATTCTCCTCAAACTCAGCAGCGATGATGAACTTATCTTTACCTTTACATTTGTTTTGCGCCAG
GCGCAGCAAGCCCCACCACCGTCCAGCCATGACGCCCACCTTGCTCGCGACACAAATATCTCGGGCCTCACTTAT
GTCTGTGCTTCGACTACTCGCGAGGTCGACAATCTAGTCACCCGCGAGTTTCATGCCGACCCCAACCTGCACAAA
AACGCAAACGTAGACCTCGTCGGCGACTACAGCACCAACGGTAAATCCTCGGTATCATTCGAGTGGACGTGGAAG
TGGAAGCCGCCCAAGACGCTCGAAGACAAGGGTGGCGGTTGGAGGAACTCGTGCAGTTTTGTTGAGTATGATTCT
CGCGCCCATCGCCTTATTACCCTCGCCAGCTTTTCTTACTGGGTCTCGAGCGGCACCTCGCCCCTGAGCCATCCC
AGCTCGCCTTCACCGCCCTTTCTCCTGGCTCCTCCCCCCAAAATTCGCATTGCTTCGACGCAATCAGTCGACTCG
CGACTCACTAGAGGCGCTGAACCCGAGGAGCCTACATCTCCCTTGTTGCTACCAGTTGACTCTAATGTTGGGGCT
GTGACGCCACAGACCAAGGAGTCTTTCAAAGTTGACGTCTCATGTCCTCGACCTGGCGATGATGCCACTATATCT
GATGATGGCCCCGTGTTTCGGGCCACCCTCAAGGCTTTGGAGCAAAAAACGGGCAATATGCGCACACATATGAAG
AGAGTACTCAAAAAAGCAGAACAGGCTCAAATTGCTCAAGGCGATGCCAACGAGGCCTTCAATGCTTTTGTGGAT
GCTCTGCGTGAGGCCTCGGCCACCAATGCTAACGCTGTCCAGCCGGCTTTGGACCACTACTTTGACAAGATAGCC
CGCGCCATCTTCGACTATGAAAAGCAAAGCACGGCAAATTTACAAAGAATCATAATCGAGCCGCTCAGCAGGCTT
TATCAGGTCGACATCAAGGGAGCCGAGTCCAAGAAGAGAGAGTTTGACGAGGAGAGCAAAGACTATTATTCCTAC
GTGTCTCGGTATCTTGGCCAACGTCAAGATTCAGTAAAGGCCAAGAAGCTTGCCGAGAGTGACTCAAAGTACCAG
CACAAGCGACGCAATTTCGAGCTCAAACGTTTTGATTATTCTAATTTCGTGCAGGATCTTCATGGAGGCCGCAAG
GAACAAGAAGTCTTGTCGCACCTAACCAAGTATGCATCGGCGCAAACAAGGGGCTATCTAGCTACAGCCAACAAG
GTTGAGGGACTCTTGCCGCAGCTGGAAGCCCTCACGGCCGAGGTTCACGTGGCCGATAAAGAGTATCAATATCGC
CGTCGTGAGCGTGAGGAGAAGAGGCGCGTTCTTGAAACAGGCAACACGCTGTACAATGAGCCCGAGCAATCCAGT
GTCAGCAACGCCGTGCCTCAAGCCTCAAACTCGAATGGCAACGGCGGCAGCGCTTCTGACTCGGAGCTGGGGCGA
GCCGATAGCACCGGGTCCCAGGTCAGGAATGCCATCGCCATTGGAGGGGCTCAGCCCAGCACCGGCTACGGCGTG
GAGCTATCGAGATCTCCTGGCAGTCTTGCCCAGCCAACCATGGGTACCCCTGTGCAAGCGACCAAGTTTAAAGGG
TTTCGTGATTTGGAGGAGCGCGAATCGGGCCAGGGCACTGTTGGTGAGCGGAAAGAGGGTCTGCTGTGGGCTCTC
AACCGGCCTGGAGGGCACGTGGACCCACGGGCCTTAAACAAACAAGCATGGCACAAGTTCTGGATTGTGCTTGAT
CAGGGAAAGCTGTCCGAGTATAGCAACTGGAAGCAGAGGCTCGACCTGCACATGGATCCCATAGACCTTCGCATG
GCATCTGTGCGCGAAGCTCGAACCGCCGAGCGACGTTTTTGCTTCGAGGTGATTACACCAAGCTTCAAGCGCGTC
TACCAGGCAACATCGGAGGAAGATATGAATAGCTGGATCGTATCCATTAACAATGCACTGCAGAGCGCCATGGAG
GGCCGGGCCCTCCAAGATTGCTCCGGCGCGGCCAAGAGGCCTGCTGAATCTTCCATGCAGAGAGACATTGGATCC
GTACTGACGGGAAAGACGCATTCGCTGGGCCACGGCTCGTCCCCGTACTACTACCAGCATGCGAGTCAGGGCGGC
AGCGGGCTTCCTCTGCGCAGAACAACGGTTGGCGCAAGGCCGAGCGCAGTGCGAACGGCCAGCTCGGGCTACAAT
GACAACCCGGACCAACTGCTGCAGATGGTTCGCACTGCTGACCAAGGCAACTGCTGGTGTGCAGACTGTGGCTCT
GGGTCCAAGGTTGAGTGGGTATCCATCAACCTGGGCATTGTCCTCTGCATCGAATGCAGTGGCATTCATCGGTCG
CTGGGGACGCACATCAGCAAAGTGCGGTCGCTGACGCTAGACATCAAGTCTTTTACCATCGATATTGTCGAAGTG
CTCCTCCTGATTGGAAACAGGGTGTCAAACATGATTTGGGAGGCCAGACTGGAACCAGTCAAGAAGCCCGGACCG
TTGGCGTCTCGAGAACAGCGCTTGAAATTCATTACGGCCAAGTATGTGGAGCGGGCCTTTGTCGGACCGCTGCCA
GGCCAGGCAACGGCAGAAGAGGCCTTGCTACTCGGAATCAAGAAGAACGAGATACAAGGAGTCTTGCATGCGCTG
GCGCTCAGGGCAAACCCCAATGCCACGGACAAGATGAGGGGCACTCACGCGGTTTGGCTTGCCCTGGCGGCCGTC
GATCCCGCGTCACCCTCGCCCTCGCCGGCGCCTGGTGTAGGTTCGTCGGATGCAGACCACAAGACGACGCCGTTT
GCCGTGGCCGAACTGCTCATGCAGAACGGCGCCGACATTGCGGCTACTTTACCGCCCTTCCCCTTGGGCAAATTG
GCTCAGCAGTACTGTGAGCAGAAACAGGGTCGAGGCAACAAGGCTCCTGCTAGCGATGGGCTGTCATCACTACCG
CAGACGATAAACGCGAGCGACAAGCTCCAGCGCGAACGAGAGGCTCGGCTGCAGAAGCGAGTAAGCGCAGGCGGG
AGATTGGCCAAGTCGCCCATTCCCGAGAAATAG
Gene >OphauG2|4546
ATGGGCAACGTGAGCAGCCGGCTCGAAGACGCGCCGACTCTGTATCTCAGAGACCAGAGCCGCTGTATGTTGAAC
CGCCATGTCGTGTTGCCTGCCTCGGGTTCAGCGTGAAGCTCTGCTGACCATCCAGTAACAATCACGTCTCTTGTC
GTCACGAGTCCGCGCAAACGCAGCTCCCTCAACATTGTTCCAAATGCATTTCCAGCCAGCAGGCTGCTTGTCTCC
CGGCCTGCCGGCGAGACGGCCCCTGTAGAATACATTCAGGTGGGCTAACGTTCGGCCTTGGCTCTAGGCGTTTAC
GCTGACATCGAGGCTCTTGGATTCTCAGGACCCCGAAGCCTCCAATAACCCCAGTGGCATGCCAGCTATTCTCCT
CAAACTCAGCAGCGATGATGAACTTATCTTTACCTTTACATTTGTTTTGCGCCAGGCGCAGCAAGCCCCACCACC
GTCCAGCCATGACGCCCACCTTGCTCGCGACACAAATATCTCGGGCCTCACTTATGTCTGTGCTTCGACTACTCG
CGAGGTCGACAATCTAGTCACCCGCGAGTTTCATGCCGACCCCAACCTGCACAAAAACGCAAACGTAGACCTCGT
CGGCGACTACAGCACCAACGGTAAATCCTCGGTATCATTCGAGTGGACGTGGAAGTGGAAGCCGCCCAAGACGCT
CGAAGACAAGGGTGGCGGTTGGAGGAACTCGTGCAGTGTATGGCTCGTCTTGCGTGCTTCTTGTCCCGTCCTCCC
AAAGACTGGTATTGACTTGATTTCCTTTGCGCCCCACTAGTTTGTTGAGTATGATTCTCGCGCCCATCGCCTTAT
TACCCTCGCCAGCTTTTCTTACTGGGTCTCGAGTACGTTTTCTTGTCCGAGGCCAGACCTCGACAGTTACTGATG
TCTTGTCATCACATAGGCGGCACCTCGCCCCTGAGCCATCCCAGCTCGCCTTCACCGCCCTTTCTCCTGGCTCCT
CCCCCCAAAATTCGCATTGCTTCGACGCAATCAGTCGACTCGCGACTCACTAGAGGCGCTGAACCCGAGGAGCCT
ACATCTCCCTTGTTGCTACCAGTTGACTCTAATGTTGGGGCTGTGACGCCACAGACCAAGGAGTCTTTCAAAGTT
GACGTCTCATGTCCTCGACCTGGCGATGATGCCACTATATCTGATGATGGCCCCGTGTTTCGGGCCACCCTCAAG
GCTTTGGAGCAAAAAACGGGCAATATGCGCACACATATGAAGAGAGTACTCAAAAAAGCAGAACAGGCTCAAATT
GCTCAAGGCGATGCCAACGAGGCCTTCAATGCTTTTGTGGATGCTCTGCGTGAGGCCTCGGCCACCAATGCTAAC
GCTGTCCAGCCGGCTTTGGACCACTACTTTGACAAGATAGCCCGCGCCATCTTCGACTATGAAAAGCAAAGCACG
GCAAATTTACAAAGAATCATAATCGAGCCGCTCAGCAGGCTTTATCAGGTCGACATCAAGGGAGCCGAGTCCAAG
AAGAGAGAGTTTGACGAGGAGAGCAAAGACTATTATTCCTACGTGTCTCGGTATCTTGGCCAACGTCAAGATTCA
GTAAAGGCCAAGAAGCTTGCCGAGAGTGACTCAAAGTACCAGCACAAGCGACGCAATTTCGAGCTCAAACGTTTT
GATTATTCTAATTTCGTGCAGGATCTTCATGGAGGCCGCAAGGAACAAGAAGTCTTGTCGCACCTAACCAAGTAT
GCATCGGCGCAAACAAGGGGCTATCTAGCTACAGCCAACAAGGTTGAGGGACTCTTGCCGCAGCTGGAAGCCCTC
ACGGCCGAGGTTCACGTGGCCGATAAAGAGTATCAATATCGCCGTCGTGAGCGTGAGGAGAAGAGGCGCGTTCTT
GAAACAGGCAACACGCTGTACAATGAGCCCGAGCAATCCAGTGTCAGCAACGCCGTGCCTCAAGCCTCAAACTCG
AATGGCAACGGCGGCAGCGCTTCTGACTCGGAGCTGGGGCGAGCCGATAGCACCGGGTCCCAGGTCAGGAATGCC
ATCGCCATTGGAGGGGCTCAGCCCAGCACCGGCTACGGCGTGGAGCTATCGAGATCTCCTGGCAGTCTTGCCCAG
CCAACCATGGGTACCCCTGTGCAAGCGACCAAGTTTAAAGGGTTTCGTGATTTGGAGGAGCGCGAATCGGGCCAG
GGCACTGTTGGTGAGCGGAAAGAGGGTCTGCTGTGGGCTCTCAACCGGCCTGGAGGGCACGTGGACCCACGGGCC
TTAAACAAACAAGCATGGCACAAGTGAGTCCCAGGCAAGAGGCTTGGTGCTTGGCGCAGCTAATCTAGGATCAGG
TTCTGGATTGTGCTTGATCAGGGAAAGCTGTCCGAGTATAGCAACTGGAAGCAGAGGCTCGACCTGCACATGGAT
CCCATAGACCTTCGCATGGCATCTGTGCGCGAAGCTCGAACCGCCGAGCGACGTTTTTGCTTCGAGGTGATTACA
CCAAGCTTCAAGCGCGTCTACCAGGCAACATCGGAGGAAGATATGAATAGCTGGATCGTATCCATTAACAATGCA
CTGCAGAGCGCCATGGAGGGCCGGGCCCTCCAAGATTGCTCCGGCGCGGCCAAGAGGCCTGCTGAATCTTCCATG
CAGAGAGACATTGGATCCGTACTGACGGGAAAGACGCATTCGCTGGGCCACGGCTCGTCCCCGTACTACTACCAG
CATGCGAGTCAGGGCGGCAGCGGGCTTCCTCTGCGCAGAACAACGGTTGGCGCAAGGCCGAGCGCAGTGCGAACG
GCCAGCTCGGGCTACAATGACAACCCGGACCAACTGCTGCAGATGGTTCGCACTGCTGACCAAGGCAACTGCTGG
TGTGCAGACTGTGGCTCTGGGTCCAAGGTTGAGTGGGTATCCATCAACCTGGGCATTGTCCTCTGCATCGAATGC
AGTGGCATTCATCGGTCGCTGGGGACGCACATCAGCAAAGTGCGGTCGCTGACGCTAGACATCAAGTCTTTTACC
ATCGATATTGTCGAAGTGCTCCTCCTGATTGGAAACAGGGTGTCAAACATGATTTGGGAGGCCAGACTGGAACCA
GTCAAGAAGCCCGGACCGTTGGCGTCTCGAGAACAGCGCTTGAAATTCATTACGGCCAAGTATGTGGAGCGGGCC
TTTGTCGGACCGCTGCCAGGCCAGGCAACGGCAGAAGAGGCCTTGCTACTCGGAATCAAGAAGAACGAGATACAA
GGAGTCTTGCATGCGCTGGCGCTCAGGGCAAACCCCAATGCCACGGACAAGATGAGGGGCACTCACGCGGTTTGG
CTTGCCCTGGCGGCCGTCGATCCCGCGTCACCCTCGCCCTCGCCGGCGCCTGGTGTAGGTTCGTCGGATGCAGAC
CACAAGACGACGCCGTTTGCCGTGGCCGAACTGCTCATGCAGAACGGCGCCGACATTGCGGCTACTTTACCGCCC
TTCCCCTTGGGCAAATTGGCTCAGCAGTACTGTGAGCAGAAACAGGGTCGAGGCAACAAGGCTCCTGCTAGCGAT
GGGCTGTCATCACTACCGCAGACGATAAACGCGAGCGACAAGCTCCAGCGCGAACGAGAGGCTCGGCTGCAGAAG
CGAGTAAGCGCAGGCGGGAGATTGGCCAAGTCGCCCATTCCCGAGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail