Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4544
Gene name
LocationContig_385:1240..3068
Strand-
Gene length (bp)1828
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01399 PCI PCI domain 1.7E-13 328 429
PF18005 eIF3m_C_helix eIF3 subunit M, C-terminal helix 9.7E-07 433 461

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEK1|EIF3M_NEUCR Eukaryotic translation initiation factor 3 subunit M OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02813 PE=3 SV=1 85 506 2.0E-175
sp|Q2HE94|EIF3M_CHAGB Eukaryotic translation initiation factor 3 subunit M OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_01460 PE=3 SV=2 85 506 3.0E-166
sp|A4RK68|EIF3M_MAGO7 Eukaryotic translation initiation factor 3 subunit M OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_01595 PE=3 SV=1 84 506 2.0E-153
sp|Q0UXJ7|EIF3M_PHANO Eukaryotic translation initiation factor 3 subunit M OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_03517 PE=3 SV=2 83 505 1.0E-118
sp|Q1DQB2|EIF3M_COCIM Eukaryotic translation initiation factor 3 subunit M OS=Coccidioides immitis (strain RS) GN=CIMG_07501 PE=3 SV=1 88 466 6.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SEK1|EIF3M_NEUCR Eukaryotic translation initiation factor 3 subunit M OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU02813 PE=3 SV=1 85 506 2.0E-175
sp|Q2HE94|EIF3M_CHAGB Eukaryotic translation initiation factor 3 subunit M OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_01460 PE=3 SV=2 85 506 3.0E-166
sp|A4RK68|EIF3M_MAGO7 Eukaryotic translation initiation factor 3 subunit M OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_01595 PE=3 SV=1 84 506 2.0E-153
sp|Q0UXJ7|EIF3M_PHANO Eukaryotic translation initiation factor 3 subunit M OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_03517 PE=3 SV=2 83 505 1.0E-118
sp|Q1DQB2|EIF3M_COCIM Eukaryotic translation initiation factor 3 subunit M OS=Coccidioides immitis (strain RS) GN=CIMG_07501 PE=3 SV=1 88 466 6.0E-88
sp|A1DC62|EIF3M_NEOFI Eukaryotic translation initiation factor 3 subunit M OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_024940 PE=3 SV=1 88 466 1.0E-86
sp|Q4WG69|EIF3M_ASPFU Eukaryotic translation initiation factor 3 subunit M OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_7G03980 PE=3 SV=1 88 494 9.0E-86
sp|B0YCA6|EIF3M_ASPFC Eukaryotic translation initiation factor 3 subunit M OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_089510 PE=3 SV=1 88 494 9.0E-86
sp|A1CD85|EIF3M_ASPCL Eukaryotic translation initiation factor 3 subunit M OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_005680 PE=3 SV=1 88 466 9.0E-83
sp|Q2UDZ9|EIF3M_ASPOR Eukaryotic translation initiation factor 3 subunit M OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090026000816 PE=3 SV=1 88 466 3.0E-81
sp|Q0CPV5|EIF3M_ASPTN Eukaryotic translation initiation factor 3 subunit M OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ATEG_04279 PE=3 SV=1 88 466 1.0E-79
sp|Q5B5C1|EIF3M_EMENI Eukaryotic translation initiation factor 3 subunit M OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN4259 PE=3 SV=1 88 466 3.0E-69
sp|Q09722|EIF3M_SCHPO Eukaryotic translation initiation factor 3 subunit M OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eif3m PE=1 SV=2 83 463 3.0E-50
sp|Q7T3B0|EIF3M_DANRE Eukaryotic translation initiation factor 3 subunit M OS=Danio rerio GN=eif3m PE=2 SV=2 89 457 4.0E-31
sp|Q7L2H7|EIF3M_HUMAN Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens GN=EIF3M PE=1 SV=1 89 457 1.0E-29
sp|Q5ZJ64|EIF3M_CHICK Eukaryotic translation initiation factor 3 subunit M OS=Gallus gallus GN=EIF3M PE=2 SV=1 89 457 2.0E-29
sp|Q5R8C4|EIF3M_PONAB Eukaryotic translation initiation factor 3 subunit M OS=Pongo abelii GN=EIF3M PE=2 SV=1 89 457 2.0E-29
sp|Q99JX4|EIF3M_MOUSE Eukaryotic translation initiation factor 3 subunit M OS=Mus musculus GN=Eif3m PE=1 SV=1 89 457 4.0E-29
sp|A7SPX9|EIF3M_NEMVE Eukaryotic translation initiation factor 3 subunit M OS=Nematostella vectensis GN=v1g192238 PE=3 SV=1 89 462 4.0E-28
sp|Q3T148|EIF3M_BOVIN Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus GN=EIF3M PE=2 SV=2 89 457 6.0E-28
sp|Q54KZ8|EIF3M_DICDI Eukaryotic translation initiation factor 3 subunit M OS=Dictyostelium discoideum GN=eif3m PE=1 SV=1 166 470 1.0E-27
sp|Q6DK91|EIF3M_XENTR Eukaryotic translation initiation factor 3 subunit M OS=Xenopus tropicalis GN=eif3m PE=2 SV=1 89 457 3.0E-27
sp|Q7ZYU8|EIF3M_XENLA Eukaryotic translation initiation factor 3 subunit M OS=Xenopus laevis GN=eif3m PE=2 SV=1 89 457 6.0E-27
sp|Q4PEV8|EIF3M_USTMA Eukaryotic translation initiation factor 3 subunit M OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_01355 PE=3 SV=1 117 451 4.0E-26
sp|Q6CB51|EIF3M_YARLI Eukaryotic translation initiation factor 3 subunit M OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0C21890g PE=3 SV=1 87 474 1.0E-23
sp|B3MCZ5|EIF3M_DROAN Eukaryotic translation initiation factor 3 subunit M OS=Drosophila ananassae GN=Tango7 PE=3 SV=1 88 457 6.0E-22
sp|B4GDM5|EIF3M_DROPE Eukaryotic translation initiation factor 3 subunit M OS=Drosophila persimilis GN=Tango7 PE=3 SV=1 88 457 7.0E-22
sp|Q292F0|EIF3M_DROPS Eukaryotic translation initiation factor 3 subunit M OS=Drosophila pseudoobscura pseudoobscura GN=Tango7 PE=3 SV=1 88 457 8.0E-22
sp|B4LJT9|EIF3M_DROVI Eukaryotic translation initiation factor 3 subunit M OS=Drosophila virilis GN=Tango7 PE=3 SV=1 88 457 1.0E-21
sp|B4KT65|EIF3M_DROMO Eukaryotic translation initiation factor 3 subunit M OS=Drosophila mojavensis GN=Tango7 PE=3 SV=1 88 457 2.0E-21
sp|B3NRC6|EIF3M_DROER Eukaryotic translation initiation factor 3 subunit M OS=Drosophila erecta GN=Tango7 PE=3 SV=1 88 457 2.0E-21
sp|B0WTN3|EIF3M_CULQU Eukaryotic translation initiation factor 3 subunit M OS=Culex quinquefasciatus GN=CPIJ010525 PE=3 SV=1 88 482 2.0E-21
sp|B4P6M6|EIF3M_DROYA Eukaryotic translation initiation factor 3 subunit M OS=Drosophila yakuba GN=Tango7 PE=2 SV=1 88 457 2.0E-21
sp|B4HR14|EIF3M_DROSE Eukaryotic translation initiation factor 3 subunit M OS=Drosophila sechellia GN=Tango7 PE=3 SV=1 88 457 4.0E-21
sp|Q7JVI3|EIF3M_DROME Eukaryotic translation initiation factor 3 subunit M OS=Drosophila melanogaster GN=Tango7 PE=2 SV=1 88 457 4.0E-21
sp|B4QFD2|EIF3M_DROSI Eukaryotic translation initiation factor 3 subunit M OS=Drosophila simulans GN=Tango7 PE=3 SV=1 88 457 4.0E-21
sp|B4JW83|EIF3M_DROGR Eukaryotic translation initiation factor 3 subunit M OS=Drosophila grimshawi GN=Tango7 PE=3 SV=1 88 457 2.0E-20
sp|Q17D30|EIF3M_AEDAE Eukaryotic translation initiation factor 3 subunit M OS=Aedes aegypti GN=AAEL004347 PE=3 SV=1 88 477 2.0E-20
sp|B4MY75|EIF3M_DROWI Eukaryotic translation initiation factor 3 subunit M OS=Drosophila willistoni GN=Tango7 PE=3 SV=1 88 457 2.0E-20
sp|Q5DHT6|EIF3M_SCHJA Eukaryotic translation initiation factor 3 subunit M OS=Schistosoma japonicum GN=SJCHGC06559 PE=2 SV=1 88 470 6.0E-19
sp|A8WQY8|EIF3M_CAEBR COP9/Signalosome and eIF3 complex-shared subunit 1 OS=Caenorhabditis briggsae GN=cif-1 PE=3 SV=1 99 474 3.0E-18
sp|Q7Q068|EIF3M_ANOGA Eukaryotic translation initiation factor 3 subunit M OS=Anopheles gambiae GN=AGAP012281 PE=3 SV=2 88 476 4.0E-18
sp|Q94261|EIF3M_CAEEL COP9/Signalosome and eIF3 complex-shared subunit 1 OS=Caenorhabditis elegans GN=cif-1 PE=1 SV=1 184 474 1.0E-15
sp|P0CM90|EIF3M_CRYNJ Eukaryotic translation initiation factor 3 subunit M OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNA04920 PE=3 SV=1 295 463 5.0E-15
sp|P0CM91|EIF3M_CRYNB Eukaryotic translation initiation factor 3 subunit M OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBA4730 PE=3 SV=1 295 463 5.0E-15
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1486
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4544 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1709
Ophiocordyceps camponoti-floridani Ophcf2|07154
Ophiocordyceps camponoti-rufipedis Ophun1|3330
Ophiocordyceps kimflemingae Ophio5|2287
Ophiocordyceps subramaniannii Hirsu2|11102

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4544
MMLNMSLVFSGMASIEPRYFDARTGFSLPSRIGLRPPRETLCLDRDLELGVVSHWIRSTRKILHQAASRLGQGSE
MATSKSNGQPQLLFVDGTLEELAKEMADYLKSDEAKQLLTKGAAKEEVLSKLVAASQALSTVPEKEYTAASNLMI
HLVLQSADPKKHLPALCSNLAKPPMGNSPVHGPGLSLNALTTVFNLLKQEDPIRARVFMEIIKFLRAYGMFDSLR
PYLDKLPDWIDSWDCGEEFERKLYQEVADAALEAGEDELSYESILKALRTFDDDDKEELSSDQAQRISLRAVKMA
ISSNTHFLFQDIRAVPSVQALSESHPIYSQLLDIFAEQDLEDYNDFNDEHKGWIEQQKFDQVKLHRKMRLLTFAS
LAAATPSREIEYAKIAKALQIPEEDVEMWAIDVIRAGLVEGKLSQKRSMFLVHKVTYRVFGQRQYQELATRVDHW
RATLQNVLGVLKQEHENAKSQREREMQDLERKMNNAGMGQGVQGRRQQRERTDNDD*
Coding >OphauG2|4544
ATGATGTTGAACATGTCTCTGGTCTTTAGTGGTATGGCTAGCATTGAGCCGCGCTACTTCGACGCTCGCACTGGA
TTTTCGCTCCCCTCTCGAATTGGCCTGCGACCACCACGAGAGACTCTCTGTCTCGACCGTGACTTGGAGCTTGGG
GTTGTCTCCCACTGGATAAGAAGCACTCGCAAAATTCTGCATCAAGCAGCGTCCCGGCTGGGTCAAGGGTCCGAA
ATGGCCACCTCCAAGAGCAACGGCCAGCCCCAGCTGCTCTTTGTGGATGGAACGCTCGAGGAGCTGGCCAAAGAA
ATGGCTGACTATCTCAAGTCTGACGAAGCAAAGCAGCTTTTGACCAAGGGCGCGGCCAAAGAAGAGGTTCTCTCA
AAACTTGTGGCTGCGTCGCAGGCACTCAGCACAGTACCAGAAAAGGAGTACACGGCGGCCTCAAATCTCATGATT
CATCTTGTGCTTCAGTCGGCCGACCCGAAGAAGCACCTGCCAGCGCTATGCAGTAATCTTGCAAAACCGCCCATG
GGCAATTCGCCCGTGCATGGTCCGGGTCTGTCACTCAATGCCTTGACGACAGTGTTCAATCTGCTTAAACAGGAG
GACCCCATTCGAGCGCGCGTCTTCATGGAGATTATCAAATTTCTAAGGGCATATGGCATGTTTGATAGCCTGCGG
CCATATCTGGACAAGCTGCCCGACTGGATAGATTCGTGGGACTGTGGAGAAGAATTTGAACGCAAGCTGTACCAA
GAAGTTGCCGACGCTGCTCTCGAGGCTGGCGAAGATGAACTGAGCTATGAGTCCATTCTCAAGGCTTTGCGCACC
TTTGACGACGACGATAAGGAGGAGCTTTCTTCTGACCAGGCACAAAGAATATCTCTCCGAGCCGTCAAAATGGCC
ATTTCATCCAACACGCACTTCCTCTTTCAAGATATTCGCGCAGTTCCAAGCGTCCAGGCTCTCAGTGAATCGCAT
CCAATCTACTCTCAGCTTCTCGATATCTTTGCCGAGCAAGATCTTGAGGACTACAACGACTTCAACGATGAACAC
AAAGGCTGGATTGAGCAACAAAAGTTTGACCAGGTCAAACTGCATCGCAAGATGCGGCTTTTGACGTTTGCCAGT
CTGGCGGCGGCGACTCCAAGTCGCGAAATCGAGTACGCAAAGATTGCCAAGGCGCTCCAGATTCCAGAGGAAGAC
GTTGAGATGTGGGCCATTGATGTGATTCGAGCGGGTCTCGTTGAAGGCAAACTGTCGCAAAAGCGCAGCATGTTT
TTGGTGCACAAGGTGACATATCGCGTGTTTGGACAGAGACAGTACCAAGAATTGGCGACACGTGTCGATCATTGG
AGAGCAACATTACAAAATGTCTTGGGTGTTTTGAAGCAGGAGCACGAAAACGCAAAGAGCCAAAGAGAGCGCGAG
ATGCAGGACCTAGAGCGCAAGATGAACAATGCCGGCATGGGCCAAGGAGTACAGGGACGTCGGCAACAGCGCGAG
AGGACTGACAATGACGACTAG
Transcript >OphauG2|4544
ATGATGTTGAACATGTCTCTGGTCTTTAGTGGTATGGCTAGCATTGAGCCGCGCTACTTCGACGCTCGCACTGGA
TTTTCGCTCCCCTCTCGAATTGGCCTGCGACCACCACGAGAGACTCTCTGTCTCGACCGTGACTTGGAGCTTGGG
GTTGTCTCCCACTGGATAAGAAGCACTCGCAAAATTCTGCATCAAGCAGCGTCCCGGCTGGGTCAAGGGTCCGAA
ATGGCCACCTCCAAGAGCAACGGCCAGCCCCAGCTGCTCTTTGTGGATGGAACGCTCGAGGAGCTGGCCAAAGAA
ATGGCTGACTATCTCAAGTCTGACGAAGCAAAGCAGCTTTTGACCAAGGGCGCGGCCAAAGAAGAGGTTCTCTCA
AAACTTGTGGCTGCGTCGCAGGCACTCAGCACAGTACCAGAAAAGGAGTACACGGCGGCCTCAAATCTCATGATT
CATCTTGTGCTTCAGTCGGCCGACCCGAAGAAGCACCTGCCAGCGCTATGCAGTAATCTTGCAAAACCGCCCATG
GGCAATTCGCCCGTGCATGGTCCGGGTCTGTCACTCAATGCCTTGACGACAGTGTTCAATCTGCTTAAACAGGAG
GACCCCATTCGAGCGCGCGTCTTCATGGAGATTATCAAATTTCTAAGGGCATATGGCATGTTTGATAGCCTGCGG
CCATATCTGGACAAGCTGCCCGACTGGATAGATTCGTGGGACTGTGGAGAAGAATTTGAACGCAAGCTGTACCAA
GAAGTTGCCGACGCTGCTCTCGAGGCTGGCGAAGATGAACTGAGCTATGAGTCCATTCTCAAGGCTTTGCGCACC
TTTGACGACGACGATAAGGAGGAGCTTTCTTCTGACCAGGCACAAAGAATATCTCTCCGAGCCGTCAAAATGGCC
ATTTCATCCAACACGCACTTCCTCTTTCAAGATATTCGCGCAGTTCCAAGCGTCCAGGCTCTCAGTGAATCGCAT
CCAATCTACTCTCAGCTTCTCGATATCTTTGCCGAGCAAGATCTTGAGGACTACAACGACTTCAACGATGAACAC
AAAGGCTGGATTGAGCAACAAAAGTTTGACCAGGTCAAACTGCATCGCAAGATGCGGCTTTTGACGTTTGCCAGT
CTGGCGGCGGCGACTCCAAGTCGCGAAATCGAGTACGCAAAGATTGCCAAGGCGCTCCAGATTCCAGAGGAAGAC
GTTGAGATGTGGGCCATTGATGTGATTCGAGCGGGTCTCGTTGAAGGCAAACTGTCGCAAAAGCGCAGCATGTTT
TTGGTGCACAAGGTGACATATCGCGTGTTTGGACAGAGACAGTACCAAGAATTGGCGACACGTGTCGATCATTGG
AGAGCAACATTACAAAATGTCTTGGGTGTTTTGAAGCAGGAGCACGAAAACGCAAAGAGCCAAAGAGAGCGCGAG
ATGCAGGACCTAGAGCGCAAGATGAACAATGCCGGCATGGGCCAAGGAGTACAGGGACGTCGGCAACAGCGCGAG
AGGACTGACAATGACGACTAG
Gene >OphauG2|4544
ATGATGTTGAACATGTCTCTGGTCTTTAGTGGTATGTAGGTACGTCAGGACAAACAAGGTACCGGGGAAAAAAGT
CTAAAGAGTGTTTCTTGATTGCGCAAAGGGATGGGACATGGGATGTTCGCGTTGAAAAATTATACATGGTACGGA
GGAGTAAAGCACTGAAGCCGGAGCTGATTGGCATGTGACGAGTCACGTGGTGTTTCTAAGGCGCCCTCGCTTAGC
TCCCAGTATGTTAAGGTGTGGGGCGCAGACTCTGACTCCCCCACCACAGGGCTAGCATTGAGCCGCGCTACTTCG
ACGCTCGCACTGGATTTTCGCTCCCCTCTCGAATTGGCCTGCGACCACCACGAGAGACTCTCTGTCTCGACCGTG
ACTTGGAGCTTGGGGTTGTCTCCCACTGGATAAGAAGCACTCGCAAAATTCTGCATCAAGCAGCGTCCCGGCTGG
GTCAAGGGTCCGAAATGGCCACCTCCAAGAGCAACGGCCAGCCCCAGCTGCTCTTTGTGGATGGAACGCTCGAGG
AGCTGGCCAAAGAAATGGCTGACTATCTCAAGTCTGACGAAGCAAAGCAGCTTTTGACCAAGGGCGCGGCCAAAG
AAGAGGTTCTCTCAAAACTTGTGGCTGCGTCGCAGGCACTCAGCACAGTACCAGAAAAGGAGTACACGGCGGCCT
CAAATCTCATGATTCATCTTGTGCTTCAGTCGGCCGACCCGAAGAAGCACCTGCCAGCGCTATGCAGTAATCTTG
CAAAACCGCCCATGGGCAATTCGCCCGTGCATGGTCCGGGTCTGTCACTCAATGCCTTGACGACAGTGTTCAATC
TGCTTAAACAGGAGGACCCCATTCGAGCGCGCGTCTTCATGGAGATTATCAAATTTCTAAGGGCATATGGCATGT
TTGATAGCCTGCGGCCATATCTGGACAAGCTGCCCGACTGGATAGATTCGTGGGACTGTGGAGAAGAATTTGAAC
GCAAGCTGTACCAAGAAGTTGCCGACGCTGCTCTCGAGGCTGGCGAAGATGAGTGAGTCATGAAGATGCAATTTC
CACCGCCCTTGGCCAATGGCAGTACACTAATCGTGGGTGACTTAGACTGAGCTATGAGTCCATTCTCAAGGCTTT
GCGCACCTTTGACGACGACGATAAGGAGGAGCTTTCTTCTGACCAGGCACAAAGAATATCTCTCCGAGCCGTCAA
AATGGCCATTTCATCCAACACGCACTTCCTCTTTCAAGATATTCGCGCAGTTCCAAGCGTCCAGGCTCTCAGTGA
ATCGCATCCAATCTACTCTCAGCTTCTCGATATCTTTGCCGAGCAAGATCTTGAGGACTACAACGACTTCAACGA
TGAACACAAAGGCTGGATTGAGCAACAAAAGTTTGACCAGGTCAAACTGCATCGCAAGATGCGGCTTTTGACGTT
TGCCAGTCTGGCGGCGGCGACTCCAAGTCGCGAAATCGAGTACGCAAAGATTGCCAAGGCGCTCCAGATTCCAGA
GGAAGACGTTGAGATGTGGGCCATTGATGTGATTCGAGCGGGTCTCGTTGAAGGCAAACTGTCGCAAAAGCGCAG
CATGTTTTTGGTGCACAAGGTGACATATCGCGTGTTTGGACAGAGACAGTACCAAGAATTGGCGACACGTGTCGA
TCATTGGAGAGCAACATTACAAAATGTCTTGGGTGTTTTGAAGCAGGAGCACGAAAACGCAAAGAGCCAAAGAGA
GCGCGAGATGCAGGACCTAGAGCGCAAGATGAACAATGCCGGCATGGGCCAAGGAGTACAGGGACGTCGGCAACA
GCGCGAGAGGACTGACAATGACGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail