Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4532
Gene name
LocationContig_383:4069..5014
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12923 RRP7 Ribosomal RNA-processing protein 7 (RRP7) C-terminal domain 3.2E-29 194 312
PF17799 RRM_Rrp7 Rrp7 RRM-like N-terminal domain 4.0E-13 11 175

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94683|RRP7_SCHPO Ribosomal RNA-processing protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp7 PE=3 SV=2 225 312 2.0E-14
sp|P25368|RRP7_YEAST Ribosomal RNA-processing protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP7 PE=1 SV=1 11 314 8.0E-11
sp|Q9D1C9|RRP7A_MOUSE Ribosomal RNA-processing protein 7 homolog A OS=Mus musculus GN=Rrp7a PE=2 SV=1 197 312 1.0E-08
sp|Q5RA17|RRP7A_PONAB Ribosomal RNA-processing protein 7 homolog A OS=Pongo abelii GN=RRP7A PE=2 SV=1 197 312 9.0E-07
sp|Q9Y3A4|RRP7A_HUMAN Ribosomal RNA-processing protein 7 homolog A OS=Homo sapiens GN=RRP7A PE=1 SV=2 197 312 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1473
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4532 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5391
Ophiocordyceps camponoti-floridani Ophcf2|00763
Ophiocordyceps camponoti-rufipedis Ophun1|1363
Ophiocordyceps kimflemingae Ophio5|4457
Ophiocordyceps subramaniannii Hirsu2|1106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4532
MASTDLASEQFDILPIRMPSISSFPHAAIHEVRVRRNTPKIPTPIDSRSLFLKNVPVDSTEEHFRAIFAALVGVG
RFESIIFDTDNPEPLFTADPLEAIKVSGFVRKRKRSDQELEKKASQEEATRLPQIWTRKLHRSSGTAIVVLADEK
SVQLVLKAMAKVRRTGKYPVWGHNVSGDVPDLGSTWVMSHLRLCRADKDTTQRAVHAFFNLFNEKEKEAAELAKS
LRNEPDEDGFVTVTRGGRAAPASRHDAEEARRRMLEKQAERKSETKNFYRFQLREMRKREQIALQKRFEQDRRKV
DAMREKRGRFKPET*
Coding >OphauG2|4532
ATGGCATCCACAGACCTTGCATCCGAGCAATTCGATATTTTGCCTATCCGAATGCCGTCAATCTCCTCGTTCCCG
CATGCTGCTATTCACGAAGTACGAGTCCGACGCAACACACCTAAAATCCCAACTCCAATTGATTCGCGCAGTCTC
TTCCTAAAAAATGTACCGGTAGATAGCACCGAGGAACACTTTAGGGCCATATTCGCTGCTCTTGTCGGGGTCGGA
CGTTTTGAGAGTATTATTTTCGATACTGATAATCCGGAACCTCTTTTTACGGCAGATCCCTTGGAAGCCATCAAG
GTCTCAGGCTTCGTACGGAAACGCAAAAGGAGTGACCAGGAATTGGAGAAAAAGGCTTCTCAAGAAGAGGCTACG
AGACTACCCCAAATCTGGACACGGAAGCTTCACAGGAGTAGCGGAACTGCAATAGTTGTGCTCGCGGACGAAAAG
AGCGTTCAGCTGGTGCTCAAAGCGATGGCAAAGGTTCGAAGGACGGGCAAGTATCCCGTCTGGGGCCACAACGTA
TCAGGAGATGTGCCCGATCTGGGATCAACGTGGGTGATGTCTCATCTGCGGCTCTGCAGAGCCGACAAGGATACA
ACACAAAGAGCCGTTCATGCCTTTTTCAACCTCTTCAACGAGAAAGAGAAGGAGGCGGCAGAGTTGGCAAAGAGT
TTGCGAAATGAGCCCGACGAAGATGGCTTTGTCACTGTTACTCGTGGCGGCCGCGCCGCCCCTGCAAGCCGCCAC
GATGCCGAAGAGGCCCGACGAAGAATGCTGGAAAAGCAGGCCGAGAGGAAGTCTGAGACGAAAAACTTTTACCGG
TTTCAGCTACGAGAGATGCGGAAGCGAGAGCAGATTGCCCTCCAGAAACGATTTGAGCAAGACAGACGCAAAGTC
GACGCTATGCGGGAAAAGCGAGGCAGGTTCAAGCCCGAGACTTGA
Transcript >OphauG2|4532
ATGGCATCCACAGACCTTGCATCCGAGCAATTCGATATTTTGCCTATCCGAATGCCGTCAATCTCCTCGTTCCCG
CATGCTGCTATTCACGAAGTACGAGTCCGACGCAACACACCTAAAATCCCAACTCCAATTGATTCGCGCAGTCTC
TTCCTAAAAAATGTACCGGTAGATAGCACCGAGGAACACTTTAGGGCCATATTCGCTGCTCTTGTCGGGGTCGGA
CGTTTTGAGAGTATTATTTTCGATACTGATAATCCGGAACCTCTTTTTACGGCAGATCCCTTGGAAGCCATCAAG
GTCTCAGGCTTCGTACGGAAACGCAAAAGGAGTGACCAGGAATTGGAGAAAAAGGCTTCTCAAGAAGAGGCTACG
AGACTACCCCAAATCTGGACACGGAAGCTTCACAGGAGTAGCGGAACTGCAATAGTTGTGCTCGCGGACGAAAAG
AGCGTTCAGCTGGTGCTCAAAGCGATGGCAAAGGTTCGAAGGACGGGCAAGTATCCCGTCTGGGGCCACAACGTA
TCAGGAGATGTGCCCGATCTGGGATCAACGTGGGTGATGTCTCATCTGCGGCTCTGCAGAGCCGACAAGGATACA
ACACAAAGAGCCGTTCATGCCTTTTTCAACCTCTTCAACGAGAAAGAGAAGGAGGCGGCAGAGTTGGCAAAGAGT
TTGCGAAATGAGCCCGACGAAGATGGCTTTGTCACTGTTACTCGTGGCGGCCGCGCCGCCCCTGCAAGCCGCCAC
GATGCCGAAGAGGCCCGACGAAGAATGCTGGAAAAGCAGGCCGAGAGGAAGTCTGAGACGAAAAACTTTTACCGG
TTTCAGCTACGAGAGATGCGGAAGCGAGAGCAGATTGCCCTCCAGAAACGATTTGAGCAAGACAGACGCAAAGTC
GACGCTATGCGGGAAAAGCGAGGCAGGTTCAAGCCCGAGACTTGA
Gene >OphauG2|4532
ATGGCATCCACAGACCTTGCATCCGAGCAATTCGATATTTTGCCTATCCGAATGCCGTCAATCTCCTCGTTCCCG
CATGCTGCTATTCACGAAGTACGAGTCCGACGCAACACACCTAAAATCCCAACTCCAATTGATTCGCGCAGTCTC
TTCCTAAAAAATGTACCGGTAGATAGCACCGAGGAACACTTTAGGGCCATATTCGCTGCTCTTGTCGGGGTCGGA
CGTTTTGAGAGTATTATTTTCGATACTGATAATCCGGAACCTCTTTTTACGGCAGATCCCTTGGAAGCCATCAAG
GTCTCAGGCTTCGTACGGAAACGCAAAAGGAGTGACCAGGAATTGGAGAAAAAGGCTTCTCAAGAAGAGGCTACG
AGACTACCCCAAATCTGGACACGGAAGCTTCACAGGAGTAGCGGAACTGCAATAGTTGTGCTCGCGGACGAAAAG
AGCGTTCAGCTGGTGCTCAAAGCGATGGCAAAGGTTCGAAGGACGGGCAAGTATCCCGTCTGGGGCCACAACGTA
TCAGGAGATGTGCCCGATCTGGGATCAACGTGGGTGATGTCTCATCTGCGGCTCTGCAGAGCCGACAAGGATACA
ACACAAAGAGCCGTTCATGCCTTTTTCAACCTCTTCAACGAGAAAGAGAAGGAGGCGGCAGAGTTGGCAAAGAGT
TTGCGAAATGAGCCCGACGAAGATGGCTTTGTCACTGTTACTCGTGGCGGCCGCGCCGCCCCTGCAAGCCGCCAC
GATGCCGAAGAGGCCCGACGAAGAATGCTGGAAAAGCAGGCCGAGAGGAAGTCTGAGACGAAAAACTTTTACCGG
TTTCAGCTACGAGAGATGCGGAAGCGAGAGCAGATTGCCCTCCAGAAACGATTTGAGCAAGACAGACGCAAAGTC
GACGCTATGCGGGAAAAGCGAGGCAGGTTCAAGCCCGAGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail