Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4527
Gene name
LocationContig_382:8791..10203
Strand+
Gene length (bp)1412
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.7E-41 164 292
PF09336 Vps4_C Vps4 C terminal oligomerisation domain 1.1E-24 366 426
PF04212 MIT MIT (microtubule interacting and transport) domain 2.4E-15 7 71
PF17862 AAA_lid_3 AAA+ lid domain 8.8E-07 318 351
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 6.6E-07 157 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AG40|VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 2 429 0.0E+00
sp|P52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 1 429 7.0E-180
sp|Q0VD48|VPS4B_BOVIN Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1 3 429 4.0E-157
sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 8 429 6.0E-157
sp|Q5R658|VPS4B_PONAB Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 8 429 4.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AG40|VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 2 429 0.0E+00
sp|P52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 1 429 7.0E-180
sp|Q0VD48|VPS4B_BOVIN Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1 3 429 4.0E-157
sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 8 429 6.0E-157
sp|Q5R658|VPS4B_PONAB Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 8 429 4.0E-156
sp|Q9UN37|VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A OS=Homo sapiens GN=VPS4A PE=1 SV=1 1 428 4.0E-156
sp|Q09803|VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1 8 429 2.0E-155
sp|Q793F9|VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus GN=Vps4a PE=1 SV=1 1 428 3.0E-155
sp|Q8VEJ9|VPS4A_MOUSE Vacuolar protein sorting-associated protein 4A OS=Mus musculus GN=Vps4a PE=1 SV=1 1 428 3.0E-155
sp|Q54PT2|VPS4_DICDI Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum GN=vps4 PE=3 SV=1 3 429 6.0E-153
sp|P46467|VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus GN=Vps4b PE=1 SV=2 2 429 4.0E-149
sp|Q9ZNT0|VPS4_ARATH Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana GN=SKD1 PE=1 SV=1 1 429 1.0E-144
sp|Q5U3S1|KATL1_DANRE Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 110 427 5.0E-88
sp|Q9SEX2|KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana GN=AAA1 PE=1 SV=1 101 427 2.0E-86
sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 106 427 1.0E-85
sp|Q0IIR9|KTNA1_XENTR Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 107 427 1.0E-85
sp|O61577|KTNA1_STRPU Katanin p60 ATPase-containing subunit A1 OS=Strongylocentrotus purpuratus GN=KATNA1 PE=1 SV=1 92 427 7.0E-85
sp|Q1HGK7|KTNA1_CHICK Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1 107 427 1.0E-84
sp|B5X3X5|KTNA1_SALSA Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 64 427 1.0E-84
sp|Q9PUL2|KTNA1_XENLA Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1 107 426 1.0E-84
sp|Q4R407|KTNA1_MACFA Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 107 427 3.0E-84
sp|O75449|KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 107 427 3.0E-84
sp|Q6E0V2|KTNA1_RAT Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1 80 427 4.0E-84
sp|Q9WV86|KTNA1_MOUSE Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1 107 427 6.0E-83
sp|Q9BW62|KATL1_HUMAN Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens GN=KATNAL1 PE=1 SV=1 77 427 1.0E-82
sp|B4USW8|KATL1_OTOGA Katanin p60 ATPase-containing subunit A-like 1 OS=Otolemur garnettii GN=KATNAL1 PE=3 SV=1 107 427 2.0E-82
sp|Q5XIK7|KATL1_RAT Katanin p60 ATPase-containing subunit A-like 1 OS=Rattus norvegicus GN=Katnal1 PE=1 SV=1 107 427 3.0E-82
sp|B7NZ88|KATL1_RABIT Katanin p60 ATPase-containing subunit A-like 1 OS=Oryctolagus cuniculus GN=KATNAL1 PE=3 SV=1 77 427 4.0E-82
sp|Q8K0T4|KATL1_MOUSE Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus GN=Katnal1 PE=1 SV=1 107 427 6.0E-82
sp|A9RA82|KATL1_PAPAN Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1 107 427 6.0E-82
sp|B3EX35|KATL1_SORAR Katanin p60 ATPase-containing subunit A-like 1 OS=Sorex araneus GN=KATNAL1 PE=3 SV=1 107 427 9.0E-82
sp|A0JMA9|KATL2_XENTR Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus tropicalis GN=katnal2 PE=2 SV=1 104 352 4.0E-79
sp|P40328|TBP6_YEAST Probable 26S protease subunit YTA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA6 PE=1 SV=2 118 430 2.0E-78
sp|Q9D3R6|KATL2_MOUSE Katanin p60 ATPase-containing subunit A-like 2 OS=Mus musculus GN=Katnal2 PE=2 SV=2 104 350 1.0E-76
sp|Q8IYT4|KATL2_HUMAN Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens GN=KATNAL2 PE=2 SV=3 108 352 1.0E-76
sp|P39955|SAP1_YEAST Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP1 PE=1 SV=1 125 430 4.0E-73
sp|O43078|ALF1_SCHPO ATPase-like fidgetin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alf1 PE=1 SV=1 99 428 2.0E-71
sp|Q8BPY9|FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=1 SV=1 118 427 8.0E-69
sp|P34808|KTNA1_CAEEL Meiotic spindle formation protein mei-1 OS=Caenorhabditis elegans GN=mei-1 PE=1 SV=1 128 427 2.0E-68
sp|Q6GX84|FIGL1_RAT Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1 73 427 2.0E-68
sp|Q6AZT2|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 76 349 4.0E-68
sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1 101 401 7.0E-68
sp|Q6DDU8|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1 118 401 9.0E-68
sp|Q60QD1|FIGL1_CAEBR Fidgetin-like protein 1 OS=Caenorhabditis briggsae GN=figl-1 PE=3 SV=1 112 427 1.0E-67
sp|Q05AS3|SPAST_XENTR Spastin OS=Xenopus tropicalis GN=spast PE=2 SV=1 74 426 2.0E-67
sp|Q6PIW4|FIGL1_HUMAN Fidgetin-like protein 1 OS=Homo sapiens GN=FIGNL1 PE=1 SV=2 82 427 3.0E-67
sp|Q9P3U2|YKX4_SCHPO Uncharacterized AAA domain-containing protein C328.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.04 PE=3 SV=1 125 429 8.0E-67
sp|Q6NW58|SPAST_DANRE Spastin OS=Danio rerio GN=spast PE=2 SV=2 74 426 2.0E-66
sp|A8XV40|SPAST_CAEBR Probable spastin homolog spas-1 OS=Caenorhabditis briggsae GN=spas-1 PE=3 SV=2 125 349 2.0E-66
sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 118 368 7.0E-66
sp|Q8MNV0|SPAST_CAEEL Probable spastin homolog spas-1 OS=Caenorhabditis elegans GN=spas-1 PE=1 SV=2 125 427 3.0E-65
sp|Q9UBP0|SPAST_HUMAN Spastin OS=Homo sapiens GN=SPAST PE=1 SV=1 125 426 2.0E-63
sp|A2VDN5|SPAST_BOVIN Spastin OS=Bos taurus GN=SPAST PE=2 SV=1 125 426 3.0E-63
sp|Q9QYY8|SPAST_MOUSE Spastin OS=Mus musculus GN=Spast PE=1 SV=3 125 426 4.0E-63
sp|B2RYN7|SPAST_RAT Spastin OS=Rattus norvegicus GN=Spast PE=1 SV=1 125 426 5.0E-63
sp|Q9VQN8|FIGL1_DROME Fidgetin-like protein 1 OS=Drosophila melanogaster GN=CG3326 PE=2 SV=2 107 426 6.0E-63
sp|B7PXE3|SPAST_IXOSC Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1 80 349 6.0E-63
sp|B4NBP4|SPAST_DROWI Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1 91 384 2.0E-62
sp|Q719N1|SPAST_PIG Spastin (Fragment) OS=Sus scrofa GN=SPAST PE=2 SV=2 125 426 2.0E-62
sp|B4JII0|SPAST_DROGR Spastin OS=Drosophila grimshawi GN=spas PE=3 SV=1 125 384 1.0E-61
sp|B4K799|SPAST_DROMO Spastin OS=Drosophila mojavensis GN=spas PE=3 SV=1 108 384 1.0E-61
sp|Q7QBW0|SPAST_ANOGA Spastin OS=Anopheles gambiae GN=spas PE=3 SV=6 109 349 2.0E-61
sp|B4M0H8|SPAST_DROVI Spastin OS=Drosophila virilis GN=spas PE=3 SV=1 125 384 3.0E-61
sp|A8QFF6|SPAST_BRUMA Probable spastin homolog Bm1_53365 OS=Brugia malayi GN=Bm1_53365 PE=3 SV=1 19 358 1.0E-60
sp|B3M301|SPAST_DROAN Spastin OS=Drosophila ananassae GN=spas PE=3 SV=1 125 384 2.0E-60
sp|Q3B8D5|KATL2_XENLA Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus laevis GN=katnal2 PE=2 SV=1 104 427 4.0E-60
sp|Q298L4|SPAST_DROPS Spastin OS=Drosophila pseudoobscura pseudoobscura GN=spas PE=3 SV=1 125 349 7.0E-60
sp|B4G437|SPAST_DROPE Spastin OS=Drosophila persimilis GN=spas PE=3 SV=1 125 349 9.0E-60
sp|O16299|FIGL1_CAEEL Fidgetin-like protein 1 OS=Caenorhabditis elegans GN=figl-1 PE=1 SV=1 112 349 1.0E-57
sp|B4HGG6|SPAST_DROSE Spastin OS=Drosophila sechellia GN=spas PE=3 SV=1 125 384 3.0E-57
sp|Q8I0P1|SPAST_DROME Spastin OS=Drosophila melanogaster GN=spas PE=1 SV=2 125 384 3.0E-57
sp|B3P8A3|SPAST_DROER Spastin OS=Drosophila erecta GN=spas PE=3 SV=1 125 384 3.0E-57
sp|B4PL32|SPAST_DROYA Spastin OS=Drosophila yakuba GN=spas PE=3 SV=1 125 384 3.0E-57
sp|B4QSF0|SPAST_DROSI Spastin OS=Drosophila simulans GN=spas PE=3 SV=1 125 384 1.0E-56
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 118 425 2.0E-56
sp|Q54KQ7|SPAST_DICDI Spastin OS=Dictyostelium discoideum GN=DDB_G0287165 PE=3 SV=1 107 349 8.0E-54
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 119 417 3.0E-52
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 81 428 2.0E-49
sp|Q5HY92|FIGN_HUMAN Fidgetin OS=Homo sapiens GN=FIGN PE=1 SV=2 114 426 5.0E-49
sp|Q58576|PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 119 349 1.0E-48
sp|Q505J9|ATAD1_RAT ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1 124 353 2.0E-48
sp|F6QV99|ATAD1_BOVIN ATPase family AAA domain-containing protein 1 OS=Bos taurus GN=ATAD1 PE=2 SV=2 124 353 2.0E-48
sp|Q9D5T0|ATAD1_MOUSE ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1 124 353 2.0E-48
sp|Q8NBU5|ATAD1_HUMAN ATPase family AAA domain-containing protein 1 OS=Homo sapiens GN=ATAD1 PE=1 SV=1 124 353 2.0E-48
sp|Q9ERZ6|FIGN_MOUSE Fidgetin OS=Mus musculus GN=Fign PE=1 SV=1 114 426 3.0E-48
sp|Q503W7|ATD1B_DANRE ATPase family AAA domain-containing protein 1-B OS=Danio rerio GN=atad1b PE=2 SV=2 124 351 8.0E-48
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 112 351 9.0E-48
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 112 428 1.0E-47
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 123 350 3.0E-47
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 112 428 4.0E-47
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 108 349 4.0E-47
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 112 415 4.0E-47
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 118 367 6.0E-47
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 118 353 8.0E-47
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 118 348 2.0E-46
sp|Q503S1|FIGN_DANRE Fidgetin OS=Danio rerio GN=fign PE=2 SV=1 118 426 2.0E-46
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 57 361 3.0E-46
sp|Q8U4H3|PAN_PYRFU Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 113 348 4.0E-46
sp|Q8TX03|PAN_METKA Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 77 348 5.0E-46
sp|Q5JHS5|PAN_THEKO Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 121 347 6.0E-46
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 119 356 7.0E-46
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 112 428 8.0E-46
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 119 348 8.0E-46
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 119 356 9.0E-46
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 119 348 1.0E-45
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 112 368 1.0E-45
sp|C5A6P8|PAN_THEGJ Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 121 347 2.0E-45
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 119 348 2.0E-45
sp|Q9P7J5|YJNA_SCHPO Uncharacterized AAA domain-containing protein C24B10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.10c PE=3 SV=1 115 350 2.0E-45
sp|B6YXR2|PAN_THEON Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 121 347 2.0E-45
sp|Q9V287|PAN_PYRAB Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 121 348 2.0E-45
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 96 417 3.0E-45
sp|B4F6J6|ATAD1_XENTR ATPase family AAA domain-containing protein 1 OS=Xenopus tropicalis GN=atad1 PE=2 SV=2 125 347 3.0E-45
sp|O57940|PAN_PYRHO Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 121 348 4.0E-45
sp|Q975U2|PAN_SULTO Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 121 341 4.0E-45
sp|O28303|PAN_ARCFU Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 114 348 8.0E-45
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 123 426 1.0E-44
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 125 350 1.0E-44
sp|Q7ZZ25|ATD1A_DANRE ATPase family AAA domain-containing protein 1-A OS=Danio rerio GN=atad1a PE=2 SV=2 125 361 1.0E-44
sp|O26824|PAN_METTH Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 113 347 2.0E-44
sp|C3N7K8|PAN_SULIY Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 121 347 2.0E-44
sp|C3NFW6|PAN_SULIN Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 121 347 2.0E-44
sp|C3MY47|PAN_SULIM Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 121 347 2.0E-44
sp|C3MRF1|PAN_SULIL Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 121 347 2.0E-44
sp|C4KIR6|PAN_SULIK Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 121 347 2.0E-44
sp|C3MZI6|PAN_SULIA Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 121 347 2.0E-44
sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 111 341 2.0E-44
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 118 368 3.0E-44
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 112 417 4.0E-44
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 112 428 6.0E-44
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 112 394 7.0E-44
sp|Q980M1|PAN_SULSO Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 121 347 1.0E-43
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 125 422 7.0E-43
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 124 347 9.0E-43
sp|P62335|PRS10_ICTTR 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 124 347 9.0E-43
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 124 347 9.0E-43
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 124 347 1.0E-42
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 125 350 1.0E-42
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 112 427 1.0E-42
sp|Q8TI88|PAN_METAC Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2 125 348 2.0E-42
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 125 351 2.0E-42
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 125 428 3.0E-42
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 112 342 3.0E-42
sp|Q8PY58|PAN_METMA Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1 121 348 4.0E-42
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 112 348 5.0E-42
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 125 428 6.0E-42
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 125 428 1.0E-41
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 125 428 2.0E-41
sp|Q6CPV1|PEX6_KLULA Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 123 428 2.0E-41
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 119 347 2.0E-41
sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 112 348 2.0E-41
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 125 428 3.0E-41
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 125 428 3.0E-41
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 125 428 3.0E-41
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 125 428 4.0E-41
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 125 428 4.0E-41
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 96 417 5.0E-41
sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 121 348 5.0E-41
sp|Q9HRW6|PAN1_HALSA Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3 119 347 5.0E-41
sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 86 348 7.0E-41
sp|Q9YAC7|PAN_AERPE Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 119 348 7.0E-41
sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 118 348 7.0E-41
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 125 428 8.0E-41
sp|B8GGN4|PAN_METPE Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 112 347 8.0E-41
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 125 428 8.0E-41
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 125 348 9.0E-41
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 125 423 1.0E-40
sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 112 348 1.0E-40
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 112 348 2.0E-40
sp|P71377|FTSH_HAEIN ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 120 347 2.0E-40
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 124 347 2.0E-40
sp|B0K5A3|FTSH1_THEPX ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 125 351 2.0E-40
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 124 382 2.0E-40
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 123 426 2.0E-40
sp|Q9M895|FTSI3_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1 123 364 2.0E-40
sp|C5CES8|FTSH_KOSOT ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 124 348 2.0E-40
sp|Q6FW67|PEX6_CANGA Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1 108 419 2.0E-40
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 124 428 3.0E-40
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 119 367 3.0E-40
sp|A7I8B8|PAN_METB6 Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 116 347 3.0E-40
sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 109 347 3.0E-40
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 125 348 4.0E-40
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 124 351 4.0E-40
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 112 348 4.0E-40
sp|A6QBN8|FTSH_SULNB ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 118 348 4.0E-40
sp|Q9FXT9|PRS7_ORYSJ 26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1 109 347 4.0E-40
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 125 428 5.0E-40
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 112 341 5.0E-40
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 112 341 5.0E-40
sp|Q9ZM66|FTSH_HELPJ ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 121 362 5.0E-40
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 109 351 5.0E-40
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 112 341 6.0E-40
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 112 341 6.0E-40
sp|Q2FQ56|PAN_METHJ Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 112 348 6.0E-40
sp|Q1PDW5|FTSH6_ARATH ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 115 348 6.0E-40
sp|P71408|FTSH_HELPY ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 121 362 6.0E-40
sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 124 348 6.0E-40
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 125 428 7.0E-40
sp|Q74Z13|PEX6_ASHGO Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 123 349 7.0E-40
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 125 348 1.0E-39
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 112 341 1.0E-39
sp|C1F8X6|FTSH_ACIC5 ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 107 356 1.0E-39
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 121 348 1.0E-39
sp|P33760|PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 123 415 1.0E-39
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 112 360 1.0E-39
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 123 385 2.0E-39
sp|A8F7F7|FTSH_PSELT ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1 125 347 2.0E-39
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 109 348 2.0E-39
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 125 355 2.0E-39
sp|Q5UT56|PAN2_HALVD Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 121 347 2.0E-39
sp|B9KXV3|FTSH1_THERP ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 122 348 2.0E-39
sp|B8I4B9|FTSH_CLOCE ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 119 347 2.0E-39
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 119 356 2.0E-39
sp|Q9SEI3|PS10A_ARATH 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 118 347 2.0E-39
sp|O59824|YME1_SCHPO ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.04c PE=3 SV=1 119 341 2.0E-39
sp|Q86JA1|PRS7_DICDI 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 109 355 2.0E-39
sp|O80860|FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 110 348 2.0E-39
sp|B8H444|FTSH_CAUCN ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 118 348 2.0E-39
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 125 417 3.0E-39
sp|O64982|PRS7_PRUPE 26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1 109 347 3.0E-39
sp|A0PXM8|FTSH_CLONN ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 125 347 3.0E-39
sp|Q68XR9|FTSH_RICTY ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 123 347 3.0E-39
sp|Q4L3G8|FTSH_STAHJ ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 121 348 3.0E-39
sp|Q9SSB5|PRS7A_ARATH 26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1 109 347 3.0E-39
sp|Q92JJ9|FTSH_RICCN ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 123 347 3.0E-39
sp|Q9ZEA2|FTSH_RICPR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 123 347 3.0E-39
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 123 414 3.0E-39
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 125 355 4.0E-39
sp|P46466|PRS4_ORYSJ 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 119 354 4.0E-39
sp|Q4UN68|FTSH_RICFE ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 123 347 4.0E-39
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 109 348 4.0E-39
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 122 356 5.0E-39
sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4 121 349 5.0E-39
sp|A6TWP7|FTSH2_ALKMQ ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 125 348 5.0E-39
sp|C6V4R9|FTSH_NEORI ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 118 348 5.0E-39
sp|Q8K9G8|FTSH_BUCAP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 127 356 5.0E-39
sp|Q655S1|FTSH2_ORYSJ ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 115 348 6.0E-39
sp|B8G4Q6|FTSH_CHLAD ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 121 348 7.0E-39
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 102 352 8.0E-39
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 127 348 1.0E-38
sp|Q9MAK9|PS10B_ARATH 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 118 347 1.0E-38
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 121 347 1.0E-38
sp|Q8SQI9|PRS6B_ENCCU 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 121 347 1.0E-38
sp|A0L4S0|FTSH_MAGMM ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 125 343 2.0E-38
sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 119 348 2.0E-38
sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 119 348 2.0E-38
sp|Q0W257|PAN_METAR Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 123 347 2.0E-38
sp|O83746|FTSH_TREPA ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 113 347 2.0E-38
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 119 348 2.0E-38
sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 123 348 2.0E-38
sp|C7N914|FTSH_LEPBD ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 119 348 3.0E-38
sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 123 348 3.0E-38
sp|Q6LUJ8|FTSH_PHOPR ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 127 347 3.0E-38
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 121 348 3.0E-38
sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 121 348 3.0E-38
sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 121 348 3.0E-38
sp|Q7UUZ7|FTSH1_RHOBA ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 125 355 3.0E-38
sp|O13764|PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 123 348 3.0E-38
sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 121 348 3.0E-38
sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 121 348 3.0E-38
sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 109 348 3.0E-38
sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 109 348 3.0E-38
sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 109 348 3.0E-38
sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 109 348 3.0E-38
sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 109 348 3.0E-38
sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 122 348 3.0E-38
sp|P49825|FTSH_ODOSI ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 115 347 3.0E-38
sp|Q8W585|FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 110 348 3.0E-38
sp|P54815|MSP1_CAEEL Mitochondrial sorting homolog OS=Caenorhabditis elegans GN=mspn-1 PE=3 SV=2 127 343 3.0E-38
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 108 348 4.0E-38
sp|P63343|FTSH_SALTY ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 127 347 4.0E-38
sp|P63344|FTSH_SALTI ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 127 347 4.0E-38
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 115 356 4.0E-38
sp|Q1RGP0|FTSH_RICBR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 123 348 5.0E-38
sp|Q01939|PRS8_YEAST 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 114 348 6.0E-38
sp|P48601|PRS4_DROME 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 119 348 6.0E-38
sp|P0AAI4|FTSH_SHIFL ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 127 347 7.0E-38
sp|P0AAI3|FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 127 347 7.0E-38
sp|Q8X9L0|FTSH_ECO57 ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 127 347 7.0E-38
sp|B4SCV5|FTSH_PELPB ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 127 356 7.0E-38
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 115 356 8.0E-38
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 121 362 8.0E-38
sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 119 348 8.0E-38
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 119 347 9.0E-38
sp|Q9SL67|PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 119 354 9.0E-38
sp|P94304|FTSH_BACPE ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 120 347 9.0E-38
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 123 385 1.0E-37
sp|D1C4U5|FTSH3_SPHTD ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 121 348 1.0E-37
sp|Q1LLA9|FTSH_CUPMC ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 125 348 1.0E-37
sp|A9EXK6|FTSH4_SORC5 ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 118 348 1.0E-37
sp|P57462|FTSH_BUCAI ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 127 347 1.0E-37
sp|O19922|FTSH_CYACA ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 119 348 2.0E-37
sp|Q89AF2|FTSH_BUCBP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 120 347 2.0E-37
sp|Q9SZD4|PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1 119 354 2.0E-37
sp|Q9TJ83|FTSH_CYAME ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 122 377 2.0E-37
sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 109 348 2.0E-37
sp|Q9SSB4|PRS7B_ARATH 26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2 109 343 2.0E-37
sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 109 348 2.0E-37
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 123 387 2.0E-37
sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 124 348 2.0E-37
sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 119 348 2.0E-37
sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 125 348 2.0E-37
sp|D1J722|FTSH_ECTSI ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 110 366 3.0E-37
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 115 356 3.0E-37
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 124 348 3.0E-37
sp|P33297|PRS6A_YEAST 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 87 347 3.0E-37
sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 105 341 3.0E-37
sp|Q9HNP9|PAN2_HALSA Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 119 354 3.0E-37
sp|Q90732|PRS4_CHICK 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 105 348 3.0E-37
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 125 335 3.0E-37
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 125 348 3.0E-37
sp|Q25544|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 123 348 3.0E-37
sp|B0K657|FTSH2_THEPX ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 120 348 4.0E-37
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 102 348 4.0E-37
sp|Q9CD58|FTSH_MYCLE ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 120 348 5.0E-37
sp|P62193|PRS4_RAT 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 105 348 5.0E-37
sp|P62192|PRS4_MOUSE 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 105 348 5.0E-37
sp|P62191|PRS4_HUMAN 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 105 348 5.0E-37
sp|P9WQN2|FTSH_MYCTO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 120 348 5.0E-37
sp|Q54PN7|PRS6A_DICDI 26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1 87 348 5.0E-37
sp|P9WQN3|FTSH_MYCTU ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 120 348 5.0E-37
sp|A5U8T5|FTSH_MYCTA ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 120 348 5.0E-37
sp|P0A4V9|FTSH_MYCBO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 120 348 5.0E-37
sp|O42931|PRS7_SCHPO 26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt1 PE=1 SV=2 109 347 5.0E-37
sp|C0ZPK5|FTSH_RHOE4 ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 118 348 5.0E-37
sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 118 356 6.0E-37
sp|O16368|PRS4_CAEEL Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 105 348 7.0E-37
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 109 347 8.0E-37
sp|A7T395|SPAST_NEMVE Spastin OS=Nematostella vectensis GN=v1g144095 PE=3 SV=2 107 349 9.0E-37
sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 111 297 9.0E-37
sp|P59652|FTSH_STRR6 ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 120 348 9.0E-37
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 124 348 1.0E-36
sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 119 350 1.0E-36
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 124 348 1.0E-36
sp|O69076|FTSH_STRPN ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 120 348 1.0E-36
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 124 341 1.0E-36
sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 119 347 1.0E-36
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 120 348 1.0E-36
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 118 347 1.0E-36
sp|Q67T82|FTSH2_SYMTH ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 125 348 1.0E-36
sp|D1C1U7|FTSH1_SPHTD ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 122 348 1.0E-36
sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 119 347 1.0E-36
sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 119 347 1.0E-36
sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 119 347 1.0E-36
sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 119 347 1.0E-36
sp|P46469|FTSH_LACLA ATP-dependent zinc metalloprotease FtsH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ftsH PE=3 SV=1 125 348 2.0E-36
sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 109 348 2.0E-36
sp|D5HA94|FTSH2_SALRM ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 120 358 2.0E-36
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 121 352 2.0E-36
sp|P46502|PRS6B_CAEEL Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1 121 348 2.0E-36
sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 125 348 2.0E-36
sp|Q6MLS7|FTSH1_BDEBA ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 118 347 2.0E-36
sp|Q8S2A7|FTSH3_ORYSJ ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 125 359 2.0E-36
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 124 348 2.0E-36
sp|Q67WJ2|FTSH6_ORYSJ ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1 119 341 2.0E-36
sp|D3F124|FTSH1_CONWI ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 123 347 2.0E-36
sp|P17980|PRS6A_HUMAN 26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3 87 348 2.0E-36
sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 119 347 2.0E-36
sp|O88685|PRS6A_MOUSE 26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2 87 348 2.0E-36
sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 104 425 2.0E-36
sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 118 347 2.0E-36
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 123 348 2.0E-36
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 125 347 2.0E-36
sp|Q83FV7|FTSH_TROWT ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 109 347 3.0E-36
sp|Q63569|PRS6A_RAT 26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1 87 348 3.0E-36
sp|P37476|FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 120 348 3.0E-36
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 119 331 3.0E-36
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 119 348 3.0E-36
sp|B3QZS3|FTSH2_PHYMT ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1 118 348 3.0E-36
sp|O42586|PR6AB_XENLA 26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1 87 348 4.0E-36
sp|D3FA80|FTSH2_CONWI ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 125 347 4.0E-36
sp|Q9FH02|FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 119 351 4.0E-36
sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 87 354 4.0E-36
sp|B2A3Q4|FTSH_NATTJ ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 121 348 5.0E-36
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 123 352 5.0E-36
sp|D1C8C0|FTSH4_SPHTD ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 121 348 5.0E-36
sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 87 354 5.0E-36
sp|Q6MJV1|FTSH2_BDEBA ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1 115 348 5.0E-36
sp|A1URA3|FTSH_BARBK ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 125 343 7.0E-36
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 124 344 7.0E-36
sp|C7MC16|FTSH_BRAFD ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 120 347 7.0E-36
sp|Q39444|FTSH_CAPAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 119 351 7.0E-36
sp|Q9UVU5|PEX6_PICAN Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1 87 297 9.0E-36
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 125 368 9.0E-36
sp|Q0TTK8|FTSH_CLOP1 ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 125 347 9.0E-36
sp|B1AI94|FTSH_UREP2 ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 125 372 9.0E-36
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 124 350 1.0E-35
sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 124 344 1.0E-35
sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 119 347 1.0E-35
sp|P36612|PRS4_SCHPO 26S protease regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mts2 PE=2 SV=1 119 348 1.0E-35
sp|Q55BV5|PRS4_DICDI 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 119 354 1.0E-35
sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 124 344 1.0E-35
sp|Q6MDI5|FTSH_PARUW ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 125 348 1.0E-35
sp|Q9HG03|PEX6_PENCH Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 123 297 1.0E-35
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 124 350 2.0E-35
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 124 344 2.0E-35
sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 126 344 2.0E-35
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 121 348 2.0E-35
sp|Q9BAE0|FTSH_MEDSA ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 119 351 2.0E-35
sp|B3R057|FTSH1_PHYMT ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 127 347 2.0E-35
sp|Q1XDF9|FTSH_PYRYE ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 119 348 3.0E-35
sp|Q6KHA4|FTSH_MYCMO ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 125 355 3.0E-35
sp|B9L3S8|FTSH2_THERP ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 121 348 3.0E-35
sp|Q39102|FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 119 351 3.0E-35
sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 106 350 3.0E-35
sp|A9BJK3|FTSH3_PETMO ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1 81 347 3.0E-35
sp|A9BFL9|FTSH1_PETMO ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 125 348 3.0E-35
sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 87 348 3.0E-35
sp|P51327|FTSH_PORPU ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 119 348 4.0E-35
sp|Q1D491|FTSH_MYXXD ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 118 348 4.0E-35
sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 87 348 4.0E-35
sp|Q5Z974|FTSH1_ORYSJ ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 119 351 4.0E-35
sp|Q925S8|YMEL1_RAT ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 124 344 4.0E-35
sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 119 366 5.0E-35
sp|A0LN68|FTSH_SYNFM ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1 124 348 5.0E-35
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 124 350 6.0E-35
sp|B7J0N5|FTSH_BORBZ ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 125 383 6.0E-35
sp|B1GZK7|FTSH_UNCTG ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 125 366 6.0E-35
sp|Q8VZI8|FTSHA_ARATH ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1 125 347 7.0E-35
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 123 354 7.0E-35
sp|C8WEG0|FTSH_ZYMMN ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 125 348 8.0E-35
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 48 293 8.0E-35
sp|Q3JMH0|FTSH_BURP1 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2 119 343 8.0E-35
sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 120 348 9.0E-35
sp|O82150|FTSH_TOBAC ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 119 351 1.0E-34
sp|B9MPK5|FTSH_CALBD ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 125 333 1.0E-34
sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 87 348 1.0E-34
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 80 347 1.0E-34
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 123 352 2.0E-34
sp|C7M0M0|FTSH_ACIFD ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 121 348 2.0E-34
sp|B2JVU2|FTSH_BURP8 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 125 348 2.0E-34
sp|Q04Q03|FTSH_LEPBJ ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 107 348 2.0E-34
sp|B3DV46|FTSH1_METI4 ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 118 333 2.0E-34
sp|D0LWB8|FTSH_HALO1 ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 125 348 2.0E-34
sp|A9KIG5|FTSH_CLOPH ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 125 354 2.0E-34
sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 121 354 4.0E-34
sp|Q84WU8|FTSH3_ARATH ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana GN=FTSH3 PE=1 SV=1 111 356 5.0E-34
sp|Q4A5F0|FTSH_MYCS5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma synoviae (strain 53) GN=ftsH PE=3 SV=2 126 348 5.0E-34
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 125 343 6.0E-34
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 109 348 6.0E-34
sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 124 343 6.0E-34
sp|D2NQQ7|FTSH_ROTMD ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 120 347 6.0E-34
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 124 343 6.0E-34
sp|O42587|PR6AA_XENLA 26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1 87 305 8.0E-34
sp|P34124|PRS8_DICDI 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 123 348 8.0E-34
sp|A9GAW6|FTSH3_SORC5 ATP-dependent zinc metalloprotease FtsH 3 OS=Sorangium cellulosum (strain So ce56) GN=ftsH3 PE=3 SV=1 122 348 9.0E-34
sp|B3PNH3|FTSH_MYCA5 ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma arthritidis (strain 158L3-1) GN=ftsH PE=3 SV=1 124 348 1.0E-33
sp|A2ZVG7|FTSH9_ORYSJ ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH9 PE=3 SV=1 114 344 1.0E-33
sp|P40341|YTA12_YEAST Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2 125 356 1.0E-33
sp|Q7SGP2|PEX6_NEUCR Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1 123 415 1.0E-33
sp|B0B970|FTSH_CHLT2 ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 125 333 1.0E-33
sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 120 350 1.0E-33
sp|P40327|PRS4_YEAST 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 119 348 1.0E-33
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 119 353 2.0E-33
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 125 343 2.0E-33
sp|C5J6A7|FTSH_MYCCR ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147) GN=ftsH PE=3 SV=1 122 386 2.0E-33
sp|P41836|PRS8_SCHPO 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 109 348 2.0E-33
sp|P33289|PEX6_PICPA Peroxisomal biogenesis factor 6 OS=Komagataella pastoris GN=PEX6 PE=3 SV=1 111 415 3.0E-33
sp|B7T1V0|FTSH_VAULI ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 124 348 3.0E-33
sp|Q3A579|FTSH_PELCD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 120 380 3.0E-33
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 113 367 4.0E-33
sp|D2QZ34|FTSH_PIRSD ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 120 339 4.0E-33
sp|A9BHD3|FTSH2_PETMO ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 121 347 5.0E-33
sp|D1AXT4|FTSH_STRM9 ATP-dependent zinc metalloprotease FtsH OS=Streptobacillus moniliformis (strain ATCC 14647 / DSM 12112 / NCTC 10651 / 9901) GN=ftsH PE=3 SV=1 107 348 5.0E-33
sp|A2SHH9|FTSH_METPP ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1 119 348 5.0E-33
sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 112 350 5.0E-33
sp|P39925|AFG3_YEAST Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1 125 356 6.0E-33
sp|Q9SD67|FTSH7_ARATH ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 124 348 7.0E-33
sp|B8J992|FTSH_ANAD2 ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 124 348 8.0E-33
sp|Q2NIN5|FTSH_AYWBP ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 111 340 8.0E-33
sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 124 343 8.0E-33
sp|O14126|PRS6A_SCHPO 26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 119 348 8.0E-33
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 127 352 1.0E-32
sp|P24004|PEX1_YEAST Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX1 PE=1 SV=2 112 352 1.0E-32
sp|Q6BS73|PEX6_DEBHA Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2 111 415 1.0E-32
sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 125 348 1.0E-32
sp|Q98PE4|FTSH_MYCPU ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ftsH PE=3 SV=1 126 348 1.0E-32
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 125 348 2.0E-32
sp|Q7URM7|FTSH2_RHOBA ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 127 347 2.0E-32
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 121 348 2.0E-32
sp|B2UMY1|FTSH_AKKM8 ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 118 351 3.0E-32
sp|O67077|FTSH_AQUAE ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 119 333 3.0E-32
sp|A9GRC9|FTSH1_SORC5 ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 125 340 4.0E-32
sp|Q9FGM0|FTSHB_ARATH ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FTSH11 PE=1 SV=1 124 344 5.0E-32
sp|Q88Z31|FTSH_LACPL ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ftsH PE=2 SV=1 125 333 5.0E-32
sp|C6VKW6|FTSH_LACPJ ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain JDM1) GN=ftsH PE=3 SV=1 125 333 5.0E-32
sp|Q60AK1|FTSH_METCA ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 125 334 6.0E-32
sp|Q9FIM2|FTSH9_ARATH ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 124 348 7.0E-32
sp|P75120|FTSH_MYCPN ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 122 347 1.0E-31
sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 119 348 1.0E-31
sp|A0JWY3|ARC_ARTS2 Proteasome-associated ATPase OS=Arthrobacter sp. (strain FB24) GN=arc PE=3 SV=1 111 318 1.0E-31
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 126 347 2.0E-31
sp|A1R6Q4|ARC_ARTAT Proteasome-associated ATPase OS=Arthrobacter aurescens (strain TC1) GN=arc PE=3 SV=1 111 318 2.0E-31
sp|Q5SI82|FTSH_THET8 ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 88 333 2.0E-31
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 125 348 2.0E-31
sp|Q8EUA6|FTSH_MYCPE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 162 348 2.0E-31
sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 105 350 4.0E-31
sp|P47695|FTSH_MYCGE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 122 347 4.0E-31
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 128 347 4.0E-31
sp|A9NE17|FTSH_ACHLI ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 117 334 4.0E-31
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 124 347 5.0E-31
sp|D3EZK2|FTSH3_CONWI ATP-dependent zinc metalloprotease FtsH 3 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH3 PE=3 SV=1 125 383 5.0E-31
sp|Q6H6R9|FTSH7_ORYSJ ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 125 343 6.0E-31
sp|C6WIC8|ARC_ACTMD Proteasome-associated ATPase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMRU 3971) GN=arc PE=3 SV=1 118 353 8.0E-31
sp|B3R0R7|FTSH3_PHYMT ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 127 347 8.0E-31
sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 105 341 9.0E-31
sp|B8H8L3|ARC_ARTCA Proteasome-associated ATPase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=arc PE=3 SV=1 111 303 9.0E-31
sp|A0LR74|FTSH_ACIC1 ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 121 340 9.0E-31
sp|Q03Z46|FTSH_LEUMM ATP-dependent zinc metalloprotease FtsH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ftsH PE=3 SV=1 125 333 1.0E-30
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 162 350 2.0E-30
sp|O74941|PEX1_SCHPO Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1 122 351 2.0E-30
sp|D1C2C6|FTSH2_SPHTD ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 125 341 2.0E-30
sp|A5W382|FTSH_PSEP1 ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 124 348 3.0E-30
sp|Q83XX3|FTSH_OENOE ATP-dependent zinc metalloprotease FtsH OS=Oenococcus oeni GN=ftsH PE=2 SV=1 125 333 3.0E-30
sp|A6NMB9|FIGL2_HUMAN Putative fidgetin-like protein 2 OS=Homo sapiens GN=FIGNL2 PE=5 SV=2 123 341 6.0E-30
sp|A1AT11|FTSH_PELPD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter propionicus (strain DSM 2379) GN=ftsH PE=3 SV=1 111 341 6.0E-30
sp|C7MWW2|ARC_SACVD Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 118 303 7.0E-30
sp|Q8NQD8|ARC_CORGL AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=arc PE=3 SV=1 111 310 7.0E-30
sp|A4QE83|ARC_CORGB AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain R) GN=arc PE=3 SV=1 111 310 7.0E-30
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 162 344 8.0E-30
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 123 353 9.0E-30
sp|A9FDV9|FTSH2_SORC5 ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 127 340 1.0E-29
sp|A1A0U4|ARC_BIFAA AAA ATPase forming ring-shaped complexes OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=arc PE=3 SV=1 102 309 1.0E-29
sp|A9WSI4|ARC_RENSM Proteasome-associated ATPase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=arc PE=3 SV=1 111 303 1.0E-29
sp|A6TSZ1|FTSH1_ALKMQ ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1 120 348 1.0E-29
sp|D3R4I7|ARC_BIFAB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain BB-12) GN=arc PE=3 SV=1 118 295 2.0E-29
sp|C6A7B2|ARC_BIFLB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain Bl-04 / DGCC2908 / RB 4825 / SD5219) GN=arc PE=3 SV=1 118 295 2.0E-29
sp|C6AHX0|ARC_BIFAS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=arc PE=3 SV=1 118 295 2.0E-29
sp|B8DTX4|ARC_BIFA0 AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=arc PE=3 SV=1 118 295 2.0E-29
sp|Q58889|PRS2_METJA Putative 26S protease regulatory subunit homolog MJ1494 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1494 PE=3 SV=2 126 346 3.0E-29
sp|B7GUP3|ARC_BIFLS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=arc PE=3 SV=1 118 297 4.0E-29
sp|Q8FTE3|ARC_COREF AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 111 309 4.0E-29
sp|Q8G3G6|ARC_BIFLO AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain NCC 2705) GN=arc PE=3 SV=1 118 297 4.0E-29
sp|D1BS23|ARC_XYLCX Proteasome-associated ATPase OS=Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07) GN=arc PE=3 SV=1 123 340 4.0E-29
sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 127 351 4.0E-29
sp|C4LIL2|ARC_CORK4 AAA ATPase forming ring-shaped complexes OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=arc PE=3 SV=2 118 310 5.0E-29
sp|B3DRN4|ARC_BIFLD AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain DJO10A) GN=arc PE=3 SV=1 118 297 5.0E-29
sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 125 344 6.0E-29
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 162 344 6.0E-28
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 124 384 5.0E-26
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 125 207 1.0E-16
sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 171 353 9.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006281 DNA repair Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0006310 DNA recombination Yes
GO:0009378 four-way junction helicase activity Yes
GO:0006950 response to stress No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0000166 nucleotide binding No
GO:0016787 hydrolase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140657 ATP-dependent activity No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0006259 DNA metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:0033554 cellular response to stress No
GO:0140097 catalytic activity, acting on DNA No
GO:1901363 heterocyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0004386 helicase activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0051716 cellular response to stimulus No
GO:0044260 cellular macromolecule metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0003678 DNA helicase activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0050896 response to stimulus No
GO:0016462 pyrophosphatase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4212
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4527 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7603
Ophiocordyceps camponoti-floridani Ophcf2|00539
Ophiocordyceps camponoti-rufipedis Ophun1|3386
Ophiocordyceps kimflemingae Ophio5|7642
Ophiocordyceps subramaniannii Hirsu2|8595

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4527
MSTNFRDRAIAEVQKAITADHNKEYQKAFDLYMSSMELWVKALKWEKNKALKATMQEKMASYLDRAEKLKQFLQS
EADGNSNGGKALMGANGASTAKGKTAPDDDDNKKLRSALSGAILQERPNVRWEDIAGLDAAKETLKEAVVLPIKF
PTLFQGKRQAWKGILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESEKLVRMLFSMARENTPSVIF
IDEIDALCGPRGEGESEASRRIKTEILIQMEGVGNDSKGILVLGATNIPWQLDAAIRRRFQRRVHIGLPDVNGRA
RMFKLAIGDTDTTLQASDYNILASRSEGFSGSDITNVVQQALMRPVRKILQATHFKPVMKEGKRMLTPCSPGDAQ
KLEMTYDDVKSDELLAPEVMLKDFELALEDSHPTVSKDDIVKQIEWTNEFGSEGA*
Coding >OphauG2|4527
ATGTCGACCAATTTTCGAGACCGGGCCATCGCCGAGGTCCAAAAGGCCATTACAGCGGACCACAACAAGGAATAC
CAAAAGGCCTTTGACCTTTACATGTCGTCGATGGAATTATGGGTAAAAGCACTGAAATGGGAAAAGAACAAGGCG
CTCAAGGCGACAATGCAGGAGAAAATGGCCTCTTACCTGGACCGTGCCGAAAAGCTCAAGCAGTTTCTTCAGTCT
GAGGCTGACGGCAACTCCAACGGCGGCAAAGCCCTCATGGGCGCCAACGGCGCTAGCACAGCCAAGGGAAAGACG
GCACCTGACGACGATGACAACAAGAAGCTTCGCAGTGCCCTGTCAGGCGCCATCTTGCAAGAAAGGCCCAATGTG
CGGTGGGAAGATATTGCGGGCTTGGACGCCGCAAAGGAGACTCTCAAGGAGGCTGTGGTGTTGCCCATCAAGTTT
CCCACCCTGTTCCAGGGGAAAAGACAAGCCTGGAAGGGCATCTTGCTCTACGGCCCGCCGGGTACGGGAAAAAGC
TATCTAGCCAAAGCTGTGGCAACCGAGGCCAATAGTACTTTTTTCAGCATCAGCAGCTCCGATTTGGTCAGCAAA
TGGATGGGTGAAAGCGAAAAACTGGTTAGAATGCTCTTTTCCATGGCGAGAGAAAACACACCGTCCGTCATCTTT
ATTGACGAAATCGATGCGCTGTGTGGCCCTCGTGGCGAAGGCGAATCGGAAGCCTCGCGGCGAATAAAGACGGAA
ATCCTGATTCAAATGGAGGGGGTAGGCAACGACAGCAAAGGTATTCTAGTTCTTGGAGCAACAAACATACCATGG
CAGCTCGATGCGGCCATTCGCCGACGCTTTCAGCGGCGAGTTCACATAGGACTGCCAGACGTCAACGGGCGGGCA
AGAATGTTTAAGCTCGCCATTGGCGACACAGACACCACACTACAGGCTAGCGACTACAACATCCTGGCGTCAAGA
TCAGAAGGATTTTCAGGCAGTGACATAACCAATGTAGTACAACAAGCACTGATGAGGCCGGTTCGCAAGATCCTG
CAGGCCACGCATTTTAAGCCGGTGATGAAGGAAGGCAAACGTATGCTTACACCATGTTCGCCTGGAGACGCCCAA
AAGTTGGAAATGACATACGATGATGTCAAGTCGGACGAGTTGCTTGCGCCTGAAGTGATGCTCAAGGACTTTGAA
TTGGCGCTTGAGGACTCGCACCCCACCGTTTCCAAGGATGATATTGTGAAGCAAATTGAGTGGACTAATGAATTT
GGAAGCGAGGGTGCGTGA
Transcript >OphauG2|4527
ATGTCGACCAATTTTCGAGACCGGGCCATCGCCGAGGTCCAAAAGGCCATTACAGCGGACCACAACAAGGAATAC
CAAAAGGCCTTTGACCTTTACATGTCGTCGATGGAATTATGGGTAAAAGCACTGAAATGGGAAAAGAACAAGGCG
CTCAAGGCGACAATGCAGGAGAAAATGGCCTCTTACCTGGACCGTGCCGAAAAGCTCAAGCAGTTTCTTCAGTCT
GAGGCTGACGGCAACTCCAACGGCGGCAAAGCCCTCATGGGCGCCAACGGCGCTAGCACAGCCAAGGGAAAGACG
GCACCTGACGACGATGACAACAAGAAGCTTCGCAGTGCCCTGTCAGGCGCCATCTTGCAAGAAAGGCCCAATGTG
CGGTGGGAAGATATTGCGGGCTTGGACGCCGCAAAGGAGACTCTCAAGGAGGCTGTGGTGTTGCCCATCAAGTTT
CCCACCCTGTTCCAGGGGAAAAGACAAGCCTGGAAGGGCATCTTGCTCTACGGCCCGCCGGGTACGGGAAAAAGC
TATCTAGCCAAAGCTGTGGCAACCGAGGCCAATAGTACTTTTTTCAGCATCAGCAGCTCCGATTTGGTCAGCAAA
TGGATGGGTGAAAGCGAAAAACTGGTTAGAATGCTCTTTTCCATGGCGAGAGAAAACACACCGTCCGTCATCTTT
ATTGACGAAATCGATGCGCTGTGTGGCCCTCGTGGCGAAGGCGAATCGGAAGCCTCGCGGCGAATAAAGACGGAA
ATCCTGATTCAAATGGAGGGGGTAGGCAACGACAGCAAAGGTATTCTAGTTCTTGGAGCAACAAACATACCATGG
CAGCTCGATGCGGCCATTCGCCGACGCTTTCAGCGGCGAGTTCACATAGGACTGCCAGACGTCAACGGGCGGGCA
AGAATGTTTAAGCTCGCCATTGGCGACACAGACACCACACTACAGGCTAGCGACTACAACATCCTGGCGTCAAGA
TCAGAAGGATTTTCAGGCAGTGACATAACCAATGTAGTACAACAAGCACTGATGAGGCCGGTTCGCAAGATCCTG
CAGGCCACGCATTTTAAGCCGGTGATGAAGGAAGGCAAACGTATGCTTACACCATGTTCGCCTGGAGACGCCCAA
AAGTTGGAAATGACATACGATGATGTCAAGTCGGACGAGTTGCTTGCGCCTGAAGTGATGCTCAAGGACTTTGAA
TTGGCGCTTGAGGACTCGCACCCCACCGTTTCCAAGGATGATATTGTGAAGCAAATTGAGTGGACTAATGAATTT
GGAAGCGAGGGTGCGTGA
Gene >OphauG2|4527
ATGTCGACCAATTTTCGAGACCGGGCCATCGCCGAGGTCCAAAAGGCCATTACAGCGGACCACAACAAGGAATAC
CAAAAGGCCTTTGACCTTTACATGTCGTCGATGGAATTATGGGTAAAAGCACTGAAATGGGAAAAGAACAAGGCG
CTCAAGGCGACAATGCAGGAGAAAATGGCCTCTTACCTGGACCGTGCCGAAAAGCTCAAGCAGTTTCTTCAGTCT
GAGGCTGACGGCAACTCCAACGGCGGCAAAGCCCTCATGGGCGCCAACGGCGCTAGCACAGCCAAGGGAAAGACG
GCACCTGACGACGATGACAACAAGAAGCTTCGCAGTGCCCTGTCAGGCGCCATCTTGCAAGAAAGGCCCAATGTG
CGGTGGGAAGATATTGCGGGCTTGGACGCCGCAAAGGAGACTCTCAAGGAGGCTGTGGTGTTGCCCATCAAGTTT
CCCACCCTGTTCCAGGGGAAAAGACAAGCCTGGAAGGGCATCTTGCTCTACGGCCCGCCGGGTACGGGAAAAAGC
TATCTAGCCAAAGCTGTGGCAACCGAGGCCAATAGTACTTTTTTCAGCATCAGCAGCTCCGATTTGGTCAGCAAA
TGGATGGGTGAAAGCGAAAAGTAAGTTGCTGTTACTACTCTGTCAATATGGGGCTCCTGTTTACTTACGCTGCTC
CACTCGTCTCTAGACTGGTTAGAATGCTCTTTTCCATGGCGAGAGAAAACACACCGTCCGTCATCTTTATTGACG
AAATCGATGCGCTGTGTGGCCCTCGTGGCGAAGGCGAATCGGAAGCCTCGCGGCGAATAAAGACGGAAATCCTGA
TTCAAATGGAGGGGGTAGGCAACGACAGCAAAGGTATTCTAGTTCTTGGAGCAACAAACATACCATGGCAGCTCG
ATGCGGCCATTCGCCGACGCTTTCAGCGGCGAGTTCACATAGGACTGCCAGACGTCAACGGGCGGGCAAGAATGT
TTAAGCTCGCCATTGGCGACACAGACACCACACTACAGGCTAGCGACTACAACATCCTGGCGTCAAGATCAGAAG
GATTTTCAGGCAGTGACATAACCAATGTAGTACAACAAGCACTGATGAGGCCGGTTCGCAAGATCCTGCAGGCCA
CGCATTTTAAGCCGGTGAGTCTACCTTGTGTTGATGGCTTCACAGCAGCTGATGGGGGACCACAGGTGATGAAGG
AAGGCAAACGTATGCTTACACCATGTTCGCCTGGAGACGCCCAAAAGTTGGAAATGACATACGATGATGTCAAGT
CGGACGAGTTGCTTGCGCCTGAAGTGATGCTCAAGGACTTTGAATTGGCGCTTGAGGACTCGCACCCCACCGTTT
CCAAGGATGATATTGTGAAGCAAATTGAGTGGACTAATGAATTTGGAAGCGAGGGTGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail