Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4525
Gene name
LocationContig_382:5341..7270
Strand-
Gene length (bp)1929
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 3.2E-13 420 525
PF08969 USP8_dimer USP8 dimerisation domain 4.2E-10 20 123
PF14464 Prok-JAB Prokaryotic homologs of the JAB domain 5.8E-06 436 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 406 598 6.0E-53
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 388 567 1.0E-43
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 381 566 5.0E-42
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 406 567 3.0E-41
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 406 567 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 406 598 6.0E-53
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 388 567 1.0E-43
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 381 566 5.0E-42
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 406 567 3.0E-41
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 406 567 4.0E-41
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 371 566 2.0E-40
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 386 596 4.0E-40
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 414 596 1.0E-39
sp|Q54Q40|D1039_DICDI Probable ubiquitin thioesterase DG1039 OS=Dictyostelium discoideum GN=DG1039 PE=3 SV=1 419 579 4.0E-39
sp|Q96FJ0|STALP_HUMAN AMSH-like protease OS=Homo sapiens GN=STAMBPL1 PE=1 SV=2 417 596 3.0E-38
sp|Q76N33|STALP_MOUSE AMSH-like protease OS=Mus musculus GN=Stambpl1 PE=1 SV=1 406 567 5.0E-38
sp|Q5R558|STALP_PONAB AMSH-like protease OS=Pongo abelii GN=STAMBPL1 PE=2 SV=1 417 596 2.0E-37
sp|Q6NKP9|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2 OS=Arabidopsis thaliana GN=AMSH2 PE=2 SV=1 419 596 5.0E-33
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 19 146 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4525
MHKLSNEMESHSSTRPARPQSVKELVAQAENFNYNANIGFKQWARAAETLDQEATFAMSDGDYGRAYVMLYRHSL
LVLDCLPSHPQFKDPESRKTHKLLAKRTNRVIGQLEHIKPILDDDYAEWERMSAAGKPEKESLKPPTTYQDFSSR
DPSLTRRAKVLDAAQNQDLAVDLAQKELARRDEARRTTPILAGPQDTGFEEQDDLQQLMKTARQTLNPKQQGEIK
HQGKAGGGLRVAPTYNYPLISKSKPIDYSLEAGPPSRIGPNRPPKEDLPPQGVADTWPRPPEPEPVPASVVHKLP
WQHEFEWQDEQPLVSHAHGPRSFQPQPVPANAAHKWPWQDVQAPMSHTRGPSSFQPEPAPANVAHKLPWQDVQAP
VSAPRGPRDAPLPPPKHALDKPTLPRKERLAFKPGAYLENGDPLRSVFLPSDLRETFLQLASKNTRAGLEMCGVL
CGTPVNNALFVQCLVIPDQTCTSDTCETENEEALFDYCTTEGWLVLGWIHTHPTQTCFMSSRDLHTHAGYQVMMP
ESIAIVCAPRFQPSYGIFRLTHPPGLNHILDCRQSNTFHHHSISNIYRDTEHPDGHVYESDKMTFIVHDLRTK*
Coding >OphauG2|4525
ATGCACAAGCTGTCCAACGAAATGGAGAGTCACTCCTCTACGCGCCCCGCGCGCCCGCAGTCTGTCAAGGAGCTG
GTGGCTCAGGCGGAAAACTTCAACTATAATGCAAACATTGGATTCAAACAATGGGCGCGAGCTGCCGAAACTCTG
GATCAAGAGGCGACGTTTGCCATGTCGGATGGCGATTATGGCCGGGCCTACGTGATGCTTTACCGCCACTCGCTG
CTCGTCCTTGACTGCCTGCCCTCGCATCCTCAGTTCAAGGATCCCGAGAGTCGCAAGACACACAAATTGCTAGCC
AAGCGCACTAACCGCGTCATCGGTCAGCTCGAGCACATTAAACCCATCTTGGACGACGATTATGCTGAATGGGAG
CGCATGTCGGCCGCGGGAAAGCCCGAAAAGGAATCTTTAAAGCCTCCAACGACCTACCAAGACTTTTCATCTCGC
GATCCTAGCTTGACCAGACGCGCCAAGGTGCTGGACGCCGCACAGAATCAGGATCTTGCCGTCGATCTGGCTCAG
AAAGAATTGGCCCGCAGAGACGAAGCCCGCCGAACAACCCCCATCTTGGCAGGTCCTCAGGACACTGGTTTTGAG
GAACAAGATGACTTGCAGCAACTCATGAAAACGGCCAGGCAGACACTGAACCCGAAGCAGCAAGGCGAAATCAAA
CACCAAGGGAAGGCTGGAGGGGGCCTGAGAGTGGCTCCTACATATAATTACCCCCTGATATCAAAATCCAAGCCC
ATCGACTACAGTCTAGAGGCTGGCCCCCCATCTCGGATTGGGCCCAACCGGCCTCCCAAAGAAGACCTTCCCCCT
CAAGGGGTGGCAGACACATGGCCTCGCCCTCCTGAACCAGAGCCGGTGCCAGCCAGCGTTGTGCACAAGTTGCCG
TGGCAACACGAGTTTGAGTGGCAAGACGAGCAACCACTCGTGTCCCATGCACATGGGCCTCGCTCTTTTCAACCA
CAGCCGGTGCCAGCCAACGCTGCCCACAAGTGGCCGTGGCAAGACGTGCAAGCACCCATGTCCCATACACGTGGG
CCTAGCTCTTTTCAACCAGAGCCGGCGCCAGCCAACGTTGCTCACAAGTTGCCGTGGCAAGACGTGCAAGCACCC
GTGTCCGCTCCACGTGGACCTCGCGATGCTCCTTTACCTCCTCCAAAGCATGCCTTGGACAAGCCGACACTGCCT
AGAAAGGAGCGGCTGGCTTTCAAGCCTGGCGCCTACCTCGAAAACGGAGACCCTCTCCGCTCCGTCTTTCTTCCT
AGCGATCTTCGGGAAACATTTCTGCAACTTGCCTCCAAGAACACAAGGGCCGGACTTGAAATGTGTGGCGTCTTG
TGCGGGACGCCAGTCAATAATGCGCTGTTTGTGCAGTGCCTCGTCATCCCTGACCAAACGTGTACCTCGGACACT
TGTGAGACGGAAAACGAGGAAGCCCTTTTTGACTACTGCACCACCGAAGGCTGGCTGGTGCTGGGGTGGATTCAC
ACACACCCTACGCAGACGTGCTTTATGAGTTCGCGCGACTTACACACGCATGCTGGATACCAGGTCATGATGCCC
GAGAGCATTGCTATAGTATGCGCCCCGAGGTTTCAGCCATCGTATGGCATCTTCCGGCTCACACACCCTCCTGGC
CTAAATCACATACTGGATTGCAGGCAATCGAACACTTTCCACCATCACTCAATCAGCAATATCTATCGCGACACG
GAGCATCCTGATGGTCATGTGTACGAAAGCGATAAGATGACCTTTATAGTGCATGACCTGCGGACCAAATAA
Transcript >OphauG2|4525
ATGCACAAGCTGTCCAACGAAATGGAGAGTCACTCCTCTACGCGCCCCGCGCGCCCGCAGTCTGTCAAGGAGCTG
GTGGCTCAGGCGGAAAACTTCAACTATAATGCAAACATTGGATTCAAACAATGGGCGCGAGCTGCCGAAACTCTG
GATCAAGAGGCGACGTTTGCCATGTCGGATGGCGATTATGGCCGGGCCTACGTGATGCTTTACCGCCACTCGCTG
CTCGTCCTTGACTGCCTGCCCTCGCATCCTCAGTTCAAGGATCCCGAGAGTCGCAAGACACACAAATTGCTAGCC
AAGCGCACTAACCGCGTCATCGGTCAGCTCGAGCACATTAAACCCATCTTGGACGACGATTATGCTGAATGGGAG
CGCATGTCGGCCGCGGGAAAGCCCGAAAAGGAATCTTTAAAGCCTCCAACGACCTACCAAGACTTTTCATCTCGC
GATCCTAGCTTGACCAGACGCGCCAAGGTGCTGGACGCCGCACAGAATCAGGATCTTGCCGTCGATCTGGCTCAG
AAAGAATTGGCCCGCAGAGACGAAGCCCGCCGAACAACCCCCATCTTGGCAGGTCCTCAGGACACTGGTTTTGAG
GAACAAGATGACTTGCAGCAACTCATGAAAACGGCCAGGCAGACACTGAACCCGAAGCAGCAAGGCGAAATCAAA
CACCAAGGGAAGGCTGGAGGGGGCCTGAGAGTGGCTCCTACATATAATTACCCCCTGATATCAAAATCCAAGCCC
ATCGACTACAGTCTAGAGGCTGGCCCCCCATCTCGGATTGGGCCCAACCGGCCTCCCAAAGAAGACCTTCCCCCT
CAAGGGGTGGCAGACACATGGCCTCGCCCTCCTGAACCAGAGCCGGTGCCAGCCAGCGTTGTGCACAAGTTGCCG
TGGCAACACGAGTTTGAGTGGCAAGACGAGCAACCACTCGTGTCCCATGCACATGGGCCTCGCTCTTTTCAACCA
CAGCCGGTGCCAGCCAACGCTGCCCACAAGTGGCCGTGGCAAGACGTGCAAGCACCCATGTCCCATACACGTGGG
CCTAGCTCTTTTCAACCAGAGCCGGCGCCAGCCAACGTTGCTCACAAGTTGCCGTGGCAAGACGTGCAAGCACCC
GTGTCCGCTCCACGTGGACCTCGCGATGCTCCTTTACCTCCTCCAAAGCATGCCTTGGACAAGCCGACACTGCCT
AGAAAGGAGCGGCTGGCTTTCAAGCCTGGCGCCTACCTCGAAAACGGAGACCCTCTCCGCTCCGTCTTTCTTCCT
AGCGATCTTCGGGAAACATTTCTGCAACTTGCCTCCAAGAACACAAGGGCCGGACTTGAAATGTGTGGCGTCTTG
TGCGGGACGCCAGTCAATAATGCGCTGTTTGTGCAGTGCCTCGTCATCCCTGACCAAACGTGTACCTCGGACACT
TGTGAGACGGAAAACGAGGAAGCCCTTTTTGACTACTGCACCACCGAAGGCTGGCTGGTGCTGGGGTGGATTCAC
ACACACCCTACGCAGACGTGCTTTATGAGTTCGCGCGACTTACACACGCATGCTGGATACCAGGTCATGATGCCC
GAGAGCATTGCTATAGTATGCGCCCCGAGGTTTCAGCCATCGTATGGCATCTTCCGGCTCACACACCCTCCTGGC
CTAAATCACATACTGGATTGCAGGCAATCGAACACTTTCCACCATCACTCAATCAGCAATATCTATCGCGACACG
GAGCATCCTGATGGTCATGTGTACGAAAGCGATAAGATGACCTTTATAGTGCATGACCTGCGGACCAAATAA
Gene >OphauG2|4525
ATGCACAAGCTGTCCAACGAAATGGAGAGTCACTCCTCTACGCGCCCCGCGCGCCCGCAGTCTGTCAAGGAGCTG
GTGGCTCAGGCGGAAAACTTCAACTATAATGCAAACATTGGATTCAAACAATGGGCGCGAGCTGCCGAAACTCTG
GATCAAGAGGTTGGCTTATCCATGCCAAGGGCATCTCTGCGGGAGCGCACGCTAACTGCATATTGCATCTCCAGG
CGACGTTTGCCATGTCGGATGGCGATTATGGCCGGGCCTACGTGATGCTTTACCGCCACTCGCTGCTCGTCCTTG
ACTGCCTGCCCTCGCATCCTCAGTTCAAGGATCCCGAGAGTCGCAAGACACACAAATTGCTAGCCAAGCGCACTA
ACCGCGTCATCGGTCAGCTCGAGCACATTAAACCCATCTTGGACGACGATTATGCTGAATGGGAGCGCATGTCGG
CCGCGGGAAAGCCCGAAAAGGAATCTTTAAAGCCTCCAACGACCTACCAAGACTTTTCATCTCGCGATCCTAGCT
TGACCAGACGCGCCAAGGTGCTGGACGCCGCACAGAATCAGGATCTTGCCGTCGATCTGGCTCAGAAAGAATTGG
CCCGCAGAGACGAAGCCCGCCGAACAACCCCCATCTTGGCAGGTCCTCAGGACACTGGTTTTGAGGAACAAGATG
ACTTGCAGCAACTCATGAAAACGGCCAGGCAGACACTGAACCCGAAGCAGCAAGGCGAAATCAAACACCAAGGGA
AGGCTGGAGGGGGCCTGAGAGTGGCTCCTACATATAATTACCCCCTGATATCAAAATCCAAGCCCATCGACTACA
GTCTAGAGGCTGGCCCCCCATCTCGGATTGGGCCCAACCGGCCTCCCAAAGAAGACCTTCCCCCTCAAGGGGTGG
CAGACACATGGCCTCGCCCTCCTGAACCAGAGCCGGTGCCAGCCAGCGTTGTGCACAAGTTGCCGTGGCAACACG
AGTTTGAGTGGCAAGACGAGCAACCACTCGTGTCCCATGCACATGGGCCTCGCTCTTTTCAACCACAGCCGGTGC
CAGCCAACGCTGCCCACAAGTGGCCGTGGCAAGACGTGCAAGCACCCATGTCCCATACACGTGGGCCTAGCTCTT
TTCAACCAGAGCCGGCGCCAGCCAACGTTGCTCACAAGTTGCCGTGGCAAGACGTGCAAGCACCCGTGTCCGCTC
CACGTGGACCTCGCGATGCTCCTTTACCTCCTCCAAAGCATGCCTTGGACAAGCCGACACTGCCTAGAAAGGAGC
GGCTGGCTTTCAAGCCTGGCGCCTACCTCGAAAACGGAGACCCTCTCCGCTCCGTCTTTCTTCCTAGCGATCTTC
GGGAAACATTTCTGCAACTTGCCTCCAAGAACACAAGGGCCGGACTTGAAATGTGTGGCGTCTTGTGCGGGACGC
CAGTCAATAATGCGCTGTTTGTGCAGTGCCTCGTCATCCCTGACCAAACGTGTACCTCGGACACTTGTGAGACGG
AAAACGAGGAAGCCCTTTTTGACTACTGCACCACCGAAGGCTGGCTGGTGCTGGGGTGGATTCACACACACCCTA
CGCAGACGTGCTTTATGAGTTCGCGCGACTTACACACGCATGCTGGATACCAGGTCATGATGCCCGAGAGCATTG
CTATAGTATGCGCCCCGAGGTTTCAGCCATCGTGAGTCTTACCAACTTGTATTTTGAAGCAGCCTTGATGCAGAG
TTAACCAAGAGTGGCATGGGCAGGTATGGCATCTTCCGGCTCACACACCCTCCTGGCCTAAATCACATACTGGAT
TGCAGGCAATCGAACACTTTCCACCATCACTCAATCAGCAATATCTATCGCGACACGGAGCATCCTGATGGTCAT
GTGTACGAAAGCGATAAGATGACCTTTATAGTGCATGACCTGCGGACCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail