Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4525
Gene name
LocationContig_382:5341..7270
Strand-
Gene length (bp)1929
Transcript length (bp)1797
Coding sequence length (bp)1797
Protein length (aa) 599

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease 3.2E-13 420 525
PF08969 USP8_dimer USP8 dimerisation domain 4.2E-10 20 123
PF14464 Prok-JAB Prokaryotic homologs of the JAB domain 5.8E-06 436 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 406 598 6.0E-53
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 388 567 1.0E-43
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 381 566 5.0E-42
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 406 567 3.0E-41
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 406 567 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 406 598 6.0E-53
sp|O95630|STABP_HUMAN STAM-binding protein OS=Homo sapiens GN=STAMBP PE=1 SV=1 388 567 1.0E-43
sp|Q63ZM7|STABP_XENLA STAM-binding protein-like OS=Xenopus laevis GN=stambp PE=2 SV=1 381 566 5.0E-42
sp|Q8R424|STABP_RAT STAM-binding protein OS=Rattus norvegicus GN=Stambp PE=2 SV=1 406 567 3.0E-41
sp|Q9CQ26|STABP_MOUSE STAM-binding protein OS=Mus musculus GN=Stambp PE=1 SV=1 406 567 4.0E-41
sp|Q6TH47|STBPA_DANRE STAM-binding protein-like A OS=Danio rerio GN=stambpa PE=2 SV=3 371 566 2.0E-40
sp|Q8VYB5|AMSH1_ARATH AMSH-like ubiquitin thioesterase 1 OS=Arabidopsis thaliana GN=AMSH1 PE=2 SV=1 386 596 4.0E-40
sp|Q5PNU3|AMSH3_ARATH AMSH-like ubiquitin thioesterase 3 OS=Arabidopsis thaliana GN=AMSH3 PE=1 SV=2 414 596 1.0E-39
sp|Q54Q40|D1039_DICDI Probable ubiquitin thioesterase DG1039 OS=Dictyostelium discoideum GN=DG1039 PE=3 SV=1 419 579 4.0E-39
sp|Q96FJ0|STALP_HUMAN AMSH-like protease OS=Homo sapiens GN=STAMBPL1 PE=1 SV=2 417 596 3.0E-38
sp|Q76N33|STALP_MOUSE AMSH-like protease OS=Mus musculus GN=Stambpl1 PE=1 SV=1 406 567 5.0E-38
sp|Q5R558|STALP_PONAB AMSH-like protease OS=Pongo abelii GN=STAMBPL1 PE=2 SV=1 417 596 2.0E-37
sp|Q6NKP9|AMSH2_ARATH AMSH-like ubiquitin thioesterase 2 OS=Arabidopsis thaliana GN=AMSH2 PE=2 SV=1 419 596 5.0E-33
sp|Q9P371|SST2_SCHPO AMSH-like protease sst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst2 PE=1 SV=1 19 146 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0070122 obsolete isopeptidase activity Yes
GO:0140492 metal-dependent deubiquitinase activity Yes
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0003674 molecular_function No
GO:0008237 metallopeptidase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0101005 deubiquitinase activity No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4210
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4525 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7601
Ophiocordyceps camponoti-floridani Ophcf2|00541
Ophiocordyceps camponoti-rufipedis Ophun1|3384
Ophiocordyceps kimflemingae Ophio5|7644
Ophiocordyceps subramaniannii Hirsu2|8593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4525
MHKLSNEMESHSSTRPARPQSVKELVAQAENFNYNANIGFKQWARAAETLDQEATFAMSDGDYGRAYVMLYRHSL
LVLDCLPSHPQFKDPESRKTHKLLAKRTNRVIGQLEHIKPILDDDYAEWERMSAAGKPEKESLKPPTTYQDFSSR
DPSLTRRAKVLDAAQNQDLAVDLAQKELARRDEARRTTPILAGPQDTGFEEQDDLQQLMKTARQTLNPKQQGEIK
HQGKAGGGLRVAPTYNYPLISKSKPIDYSLEAGPPSRIGPNRPPKEDLPPQGVADTWPRPPEPEPVPASVVHKLP
WQHEFEWQDEQPLVSHAHGPRSFQPQPVPANAAHKWPWQDVQAPMSHTRGPSSFQPEPAPANVAHKLPWQDVQAP
VSAPRGPRDAPLPPPKHALDKPTLPRKERLAFKPGAYLENGDPLRSVFLPSDLRETFLQLASKNTRAGLEMCGVL
CGTPVNNALFVQCLVIPDQTCTSDTCETENEEALFDYCTTEGWLVLGWIHTHPTQTCFMSSRDLHTHAGYQVMMP
ESIAIVCAPRFQPSYGIFRLTHPPGLNHILDCRQSNTFHHHSISNIYRDTEHPDGHVYESDKMTFIVHDLRTK*
Coding >OphauG2|4525
ATGCACAAGCTGTCCAACGAAATGGAGAGTCACTCCTCTACGCGCCCCGCGCGCCCGCAGTCTGTCAAGGAGCTG
GTGGCTCAGGCGGAAAACTTCAACTATAATGCAAACATTGGATTCAAACAATGGGCGCGAGCTGCCGAAACTCTG
GATCAAGAGGCGACGTTTGCCATGTCGGATGGCGATTATGGCCGGGCCTACGTGATGCTTTACCGCCACTCGCTG
CTCGTCCTTGACTGCCTGCCCTCGCATCCTCAGTTCAAGGATCCCGAGAGTCGCAAGACACACAAATTGCTAGCC
AAGCGCACTAACCGCGTCATCGGTCAGCTCGAGCACATTAAACCCATCTTGGACGACGATTATGCTGAATGGGAG
CGCATGTCGGCCGCGGGAAAGCCCGAAAAGGAATCTTTAAAGCCTCCAACGACCTACCAAGACTTTTCATCTCGC
GATCCTAGCTTGACCAGACGCGCCAAGGTGCTGGACGCCGCACAGAATCAGGATCTTGCCGTCGATCTGGCTCAG
AAAGAATTGGCCCGCAGAGACGAAGCCCGCCGAACAACCCCCATCTTGGCAGGTCCTCAGGACACTGGTTTTGAG
GAACAAGATGACTTGCAGCAACTCATGAAAACGGCCAGGCAGACACTGAACCCGAAGCAGCAAGGCGAAATCAAA
CACCAAGGGAAGGCTGGAGGGGGCCTGAGAGTGGCTCCTACATATAATTACCCCCTGATATCAAAATCCAAGCCC
ATCGACTACAGTCTAGAGGCTGGCCCCCCATCTCGGATTGGGCCCAACCGGCCTCCCAAAGAAGACCTTCCCCCT
CAAGGGGTGGCAGACACATGGCCTCGCCCTCCTGAACCAGAGCCGGTGCCAGCCAGCGTTGTGCACAAGTTGCCG
TGGCAACACGAGTTTGAGTGGCAAGACGAGCAACCACTCGTGTCCCATGCACATGGGCCTCGCTCTTTTCAACCA
CAGCCGGTGCCAGCCAACGCTGCCCACAAGTGGCCGTGGCAAGACGTGCAAGCACCCATGTCCCATACACGTGGG
CCTAGCTCTTTTCAACCAGAGCCGGCGCCAGCCAACGTTGCTCACAAGTTGCCGTGGCAAGACGTGCAAGCACCC
GTGTCCGCTCCACGTGGACCTCGCGATGCTCCTTTACCTCCTCCAAAGCATGCCTTGGACAAGCCGACACTGCCT
AGAAAGGAGCGGCTGGCTTTCAAGCCTGGCGCCTACCTCGAAAACGGAGACCCTCTCCGCTCCGTCTTTCTTCCT
AGCGATCTTCGGGAAACATTTCTGCAACTTGCCTCCAAGAACACAAGGGCCGGACTTGAAATGTGTGGCGTCTTG
TGCGGGACGCCAGTCAATAATGCGCTGTTTGTGCAGTGCCTCGTCATCCCTGACCAAACGTGTACCTCGGACACT
TGTGAGACGGAAAACGAGGAAGCCCTTTTTGACTACTGCACCACCGAAGGCTGGCTGGTGCTGGGGTGGATTCAC
ACACACCCTACGCAGACGTGCTTTATGAGTTCGCGCGACTTACACACGCATGCTGGATACCAGGTCATGATGCCC
GAGAGCATTGCTATAGTATGCGCCCCGAGGTTTCAGCCATCGTATGGCATCTTCCGGCTCACACACCCTCCTGGC
CTAAATCACATACTGGATTGCAGGCAATCGAACACTTTCCACCATCACTCAATCAGCAATATCTATCGCGACACG
GAGCATCCTGATGGTCATGTGTACGAAAGCGATAAGATGACCTTTATAGTGCATGACCTGCGGACCAAATAA
Transcript >OphauG2|4525
ATGCACAAGCTGTCCAACGAAATGGAGAGTCACTCCTCTACGCGCCCCGCGCGCCCGCAGTCTGTCAAGGAGCTG
GTGGCTCAGGCGGAAAACTTCAACTATAATGCAAACATTGGATTCAAACAATGGGCGCGAGCTGCCGAAACTCTG
GATCAAGAGGCGACGTTTGCCATGTCGGATGGCGATTATGGCCGGGCCTACGTGATGCTTTACCGCCACTCGCTG
CTCGTCCTTGACTGCCTGCCCTCGCATCCTCAGTTCAAGGATCCCGAGAGTCGCAAGACACACAAATTGCTAGCC
AAGCGCACTAACCGCGTCATCGGTCAGCTCGAGCACATTAAACCCATCTTGGACGACGATTATGCTGAATGGGAG
CGCATGTCGGCCGCGGGAAAGCCCGAAAAGGAATCTTTAAAGCCTCCAACGACCTACCAAGACTTTTCATCTCGC
GATCCTAGCTTGACCAGACGCGCCAAGGTGCTGGACGCCGCACAGAATCAGGATCTTGCCGTCGATCTGGCTCAG
AAAGAATTGGCCCGCAGAGACGAAGCCCGCCGAACAACCCCCATCTTGGCAGGTCCTCAGGACACTGGTTTTGAG
GAACAAGATGACTTGCAGCAACTCATGAAAACGGCCAGGCAGACACTGAACCCGAAGCAGCAAGGCGAAATCAAA
CACCAAGGGAAGGCTGGAGGGGGCCTGAGAGTGGCTCCTACATATAATTACCCCCTGATATCAAAATCCAAGCCC
ATCGACTACAGTCTAGAGGCTGGCCCCCCATCTCGGATTGGGCCCAACCGGCCTCCCAAAGAAGACCTTCCCCCT
CAAGGGGTGGCAGACACATGGCCTCGCCCTCCTGAACCAGAGCCGGTGCCAGCCAGCGTTGTGCACAAGTTGCCG
TGGCAACACGAGTTTGAGTGGCAAGACGAGCAACCACTCGTGTCCCATGCACATGGGCCTCGCTCTTTTCAACCA
CAGCCGGTGCCAGCCAACGCTGCCCACAAGTGGCCGTGGCAAGACGTGCAAGCACCCATGTCCCATACACGTGGG
CCTAGCTCTTTTCAACCAGAGCCGGCGCCAGCCAACGTTGCTCACAAGTTGCCGTGGCAAGACGTGCAAGCACCC
GTGTCCGCTCCACGTGGACCTCGCGATGCTCCTTTACCTCCTCCAAAGCATGCCTTGGACAAGCCGACACTGCCT
AGAAAGGAGCGGCTGGCTTTCAAGCCTGGCGCCTACCTCGAAAACGGAGACCCTCTCCGCTCCGTCTTTCTTCCT
AGCGATCTTCGGGAAACATTTCTGCAACTTGCCTCCAAGAACACAAGGGCCGGACTTGAAATGTGTGGCGTCTTG
TGCGGGACGCCAGTCAATAATGCGCTGTTTGTGCAGTGCCTCGTCATCCCTGACCAAACGTGTACCTCGGACACT
TGTGAGACGGAAAACGAGGAAGCCCTTTTTGACTACTGCACCACCGAAGGCTGGCTGGTGCTGGGGTGGATTCAC
ACACACCCTACGCAGACGTGCTTTATGAGTTCGCGCGACTTACACACGCATGCTGGATACCAGGTCATGATGCCC
GAGAGCATTGCTATAGTATGCGCCCCGAGGTTTCAGCCATCGTATGGCATCTTCCGGCTCACACACCCTCCTGGC
CTAAATCACATACTGGATTGCAGGCAATCGAACACTTTCCACCATCACTCAATCAGCAATATCTATCGCGACACG
GAGCATCCTGATGGTCATGTGTACGAAAGCGATAAGATGACCTTTATAGTGCATGACCTGCGGACCAAATAA
Gene >OphauG2|4525
ATGCACAAGCTGTCCAACGAAATGGAGAGTCACTCCTCTACGCGCCCCGCGCGCCCGCAGTCTGTCAAGGAGCTG
GTGGCTCAGGCGGAAAACTTCAACTATAATGCAAACATTGGATTCAAACAATGGGCGCGAGCTGCCGAAACTCTG
GATCAAGAGGTTGGCTTATCCATGCCAAGGGCATCTCTGCGGGAGCGCACGCTAACTGCATATTGCATCTCCAGG
CGACGTTTGCCATGTCGGATGGCGATTATGGCCGGGCCTACGTGATGCTTTACCGCCACTCGCTGCTCGTCCTTG
ACTGCCTGCCCTCGCATCCTCAGTTCAAGGATCCCGAGAGTCGCAAGACACACAAATTGCTAGCCAAGCGCACTA
ACCGCGTCATCGGTCAGCTCGAGCACATTAAACCCATCTTGGACGACGATTATGCTGAATGGGAGCGCATGTCGG
CCGCGGGAAAGCCCGAAAAGGAATCTTTAAAGCCTCCAACGACCTACCAAGACTTTTCATCTCGCGATCCTAGCT
TGACCAGACGCGCCAAGGTGCTGGACGCCGCACAGAATCAGGATCTTGCCGTCGATCTGGCTCAGAAAGAATTGG
CCCGCAGAGACGAAGCCCGCCGAACAACCCCCATCTTGGCAGGTCCTCAGGACACTGGTTTTGAGGAACAAGATG
ACTTGCAGCAACTCATGAAAACGGCCAGGCAGACACTGAACCCGAAGCAGCAAGGCGAAATCAAACACCAAGGGA
AGGCTGGAGGGGGCCTGAGAGTGGCTCCTACATATAATTACCCCCTGATATCAAAATCCAAGCCCATCGACTACA
GTCTAGAGGCTGGCCCCCCATCTCGGATTGGGCCCAACCGGCCTCCCAAAGAAGACCTTCCCCCTCAAGGGGTGG
CAGACACATGGCCTCGCCCTCCTGAACCAGAGCCGGTGCCAGCCAGCGTTGTGCACAAGTTGCCGTGGCAACACG
AGTTTGAGTGGCAAGACGAGCAACCACTCGTGTCCCATGCACATGGGCCTCGCTCTTTTCAACCACAGCCGGTGC
CAGCCAACGCTGCCCACAAGTGGCCGTGGCAAGACGTGCAAGCACCCATGTCCCATACACGTGGGCCTAGCTCTT
TTCAACCAGAGCCGGCGCCAGCCAACGTTGCTCACAAGTTGCCGTGGCAAGACGTGCAAGCACCCGTGTCCGCTC
CACGTGGACCTCGCGATGCTCCTTTACCTCCTCCAAAGCATGCCTTGGACAAGCCGACACTGCCTAGAAAGGAGC
GGCTGGCTTTCAAGCCTGGCGCCTACCTCGAAAACGGAGACCCTCTCCGCTCCGTCTTTCTTCCTAGCGATCTTC
GGGAAACATTTCTGCAACTTGCCTCCAAGAACACAAGGGCCGGACTTGAAATGTGTGGCGTCTTGTGCGGGACGC
CAGTCAATAATGCGCTGTTTGTGCAGTGCCTCGTCATCCCTGACCAAACGTGTACCTCGGACACTTGTGAGACGG
AAAACGAGGAAGCCCTTTTTGACTACTGCACCACCGAAGGCTGGCTGGTGCTGGGGTGGATTCACACACACCCTA
CGCAGACGTGCTTTATGAGTTCGCGCGACTTACACACGCATGCTGGATACCAGGTCATGATGCCCGAGAGCATTG
CTATAGTATGCGCCCCGAGGTTTCAGCCATCGTGAGTCTTACCAACTTGTATTTTGAAGCAGCCTTGATGCAGAG
TTAACCAAGAGTGGCATGGGCAGGTATGGCATCTTCCGGCTCACACACCCTCCTGGCCTAAATCACATACTGGAT
TGCAGGCAATCGAACACTTTCCACCATCACTCAATCAGCAATATCTATCGCGACACGGAGCATCCTGATGGTCAT
GTGTACGAAAGCGATAAGATGACCTTTATAGTGCATGACCTGCGGACCAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail