Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4523
Gene name
LocationContig_381:14704..16244
Strand+
Gene length (bp)1540
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00557 Peptidase_M24 Metallopeptidase family M24 5.2E-05 20 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09184|CDB4_SCHPO Curved DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdb4 PE=1 SV=1 2 382 1.0E-67
sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens GN=PA2G4 PE=1 SV=3 17 384 2.0E-56
sp|Q6AYD3|PA2G4_RAT Proliferation-associated protein 2G4 OS=Rattus norvegicus GN=Pa2g4 PE=1 SV=1 17 384 5.0E-56
sp|P50580|PA2G4_MOUSE Proliferation-associated protein 2G4 OS=Mus musculus GN=Pa2g4 PE=1 SV=3 17 384 7.0E-56
sp|M1CZC0|EBP1_SOLTU ERBB-3 BINDING PROTEIN 1 OS=Solanum tuberosum GN=EBP1 PE=2 SV=1 3 381 8.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09184|CDB4_SCHPO Curved DNA-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdb4 PE=1 SV=1 2 382 1.0E-67
sp|Q9UQ80|PA2G4_HUMAN Proliferation-associated protein 2G4 OS=Homo sapiens GN=PA2G4 PE=1 SV=3 17 384 2.0E-56
sp|Q6AYD3|PA2G4_RAT Proliferation-associated protein 2G4 OS=Rattus norvegicus GN=Pa2g4 PE=1 SV=1 17 384 5.0E-56
sp|P50580|PA2G4_MOUSE Proliferation-associated protein 2G4 OS=Mus musculus GN=Pa2g4 PE=1 SV=3 17 384 7.0E-56
sp|M1CZC0|EBP1_SOLTU ERBB-3 BINDING PROTEIN 1 OS=Solanum tuberosum GN=EBP1 PE=2 SV=1 3 381 8.0E-51
sp|Q96327|EBP1_ARATH ERBB-3 BINDING PROTEIN 1 OS=Arabidopsis thaliana GN=EBP1 PE=2 SV=1 3 374 4.0E-49
sp|Q1ZXG4|PRLA_DICDI Proliferation-associated protein A OS=Dictyostelium discoideum GN=prlA PE=2 SV=1 1 385 1.0E-40
sp|O60180|ARX1_SCHPO Probable metalloprotease arx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arx1 PE=3 SV=1 18 352 2.0E-20
sp|Q6CCY2|ARX1_YARLI Probable metalloprotease ARX1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARX1 PE=3 SV=1 12 406 3.0E-13
sp|Q6BI90|ARX1_DEBHA Probable metalloprotease ARX1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ARX1 PE=3 SV=2 14 301 5.0E-13
sp|Q5AI37|ARX1_CANAL Probable metalloprotease ARX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ARX1 PE=3 SV=1 20 205 5.0E-12
sp|Q58725|MAP2_METJA Methionine aminopeptidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=map PE=3 SV=1 24 349 1.0E-08
sp|Q6FL44|ARX1_CANGA Probable metalloprotease ARX1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ARX1 PE=3 SV=1 18 205 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4523
MAEEKDVVDYSLNNPDTLTKYKTAGAISEKVLAAVSKLCVPGDKIVDICQKGDKLIEEEVSKVYRGKKVIKGFSH
PTTVSPSSYVTPYTPLTSDESEAALEIQAGEAIKIQLGAQIDGFGTIVCDTILAQPEDKAGQQVSGRDADLMLAT
HYANELLLRLMLPSGLLAQGTDEEKAKAAAQKPPSQAKMTSLLEKVCESFDCHLVESTTSWLFDHNEIEGSKKIV
LAPAEGSKGDGVPATAEVWGVEMGVSLGSGKVKTIDQRATLHRRTTQTYGLKRPTSRKILSEVQKKFGTFPFSLR
QLEDERDAKLGVVECVRGNVLRQYELVGDKDNEPVARLLTTIAITKNGITKLSGPPALQVSQYKTDKKITDPEIL
KMLEQPLARNAGKKKNKGKKKKKPAKKAATETAEVDSEDDSDDDE*
Coding >OphauG2|4523
ATGGCCGAGGAAAAAGATGTCGTTGACTACTCGCTCAACAATCCCGATACCCTCACCAAGTACAAGACTGCTGGT
GCAATATCGGAAAAGGTGCTGGCGGCTGTGTCAAAGCTCTGCGTGCCTGGAGACAAGATTGTCGACATTTGCCAA
AAGGGCGACAAGCTCATTGAGGAAGAGGTATCCAAGGTCTACCGCGGCAAAAAGGTCATCAAGGGCTTCTCCCAT
CCAACCACGGTGTCGCCCTCGTCCTATGTCACTCCATACACTCCCTTGACGTCGGACGAGAGTGAAGCTGCGCTC
GAGATTCAAGCCGGCGAGGCCATCAAGATCCAACTCGGTGCCCAGATTGACGGCTTTGGCACCATTGTCTGCGAC
ACCATCCTCGCACAGCCCGAGGACAAGGCTGGCCAACAAGTCTCGGGCCGCGACGCAGACTTGATGCTGGCCACG
CACTATGCAAATGAGCTGCTGCTGCGGTTGATGCTGCCCTCTGGTCTGCTGGCGCAGGGCACCGACGAGGAAAAG
GCAAAAGCAGCCGCGCAAAAGCCCCCTAGCCAGGCCAAGATGACGAGTTTGCTGGAAAAGGTGTGCGAGAGCTTC
GACTGCCACCTTGTCGAGAGCACTACCTCATGGCTCTTTGACCATAACGAAATCGAGGGCTCCAAGAAGATTGTT
CTTGCCCCTGCTGAAGGCTCCAAGGGCGATGGTGTGCCAGCCACAGCCGAGGTCTGGGGTGTCGAGATGGGCGTT
AGTCTTGGGTCCGGAAAGGTCAAGACAATTGACCAGCGTGCCACGCTCCACCGCCGCACCACGCAGACTTATGGC
CTGAAACGCCCTACGTCGCGCAAAATTCTGTCTGAAGTGCAGAAGAAGTTTGGCACCTTTCCCTTTAGCCTGCGC
CAACTCGAGGATGAGCGTGATGCCAAGCTGGGAGTCGTCGAGTGCGTGCGCGGCAACGTGCTTCGCCAGTACGAG
CTGGTTGGCGACAAAGATAACGAGCCCGTCGCCCGCCTCTTGACAACGATTGCAATCACAAAGAATGGAATCACC
AAGCTCAGTGGCCCGCCCGCGCTGCAAGTGAGCCAGTACAAGACGGACAAGAAGATTACGGATCCAGAAATCCTC
AAGATGCTTGAGCAGCCACTGGCAAGGAATGCAGGCAAGAAGAAGAACAAGGGTAAAAAGAAGAAGAAGCCGGCC
AAGAAGGCGGCGACGGAAACTGCAGAGGTGGATTCGGAAGACGACTCGGACGACGACGAATAG
Transcript >OphauG2|4523
ATGGCCGAGGAAAAAGATGTCGTTGACTACTCGCTCAACAATCCCGATACCCTCACCAAGTACAAGACTGCTGGT
GCAATATCGGAAAAGGTGCTGGCGGCTGTGTCAAAGCTCTGCGTGCCTGGAGACAAGATTGTCGACATTTGCCAA
AAGGGCGACAAGCTCATTGAGGAAGAGGTATCCAAGGTCTACCGCGGCAAAAAGGTCATCAAGGGCTTCTCCCAT
CCAACCACGGTGTCGCCCTCGTCCTATGTCACTCCATACACTCCCTTGACGTCGGACGAGAGTGAAGCTGCGCTC
GAGATTCAAGCCGGCGAGGCCATCAAGATCCAACTCGGTGCCCAGATTGACGGCTTTGGCACCATTGTCTGCGAC
ACCATCCTCGCACAGCCCGAGGACAAGGCTGGCCAACAAGTCTCGGGCCGCGACGCAGACTTGATGCTGGCCACG
CACTATGCAAATGAGCTGCTGCTGCGGTTGATGCTGCCCTCTGGTCTGCTGGCGCAGGGCACCGACGAGGAAAAG
GCAAAAGCAGCCGCGCAAAAGCCCCCTAGCCAGGCCAAGATGACGAGTTTGCTGGAAAAGGTGTGCGAGAGCTTC
GACTGCCACCTTGTCGAGAGCACTACCTCATGGCTCTTTGACCATAACGAAATCGAGGGCTCCAAGAAGATTGTT
CTTGCCCCTGCTGAAGGCTCCAAGGGCGATGGTGTGCCAGCCACAGCCGAGGTCTGGGGTGTCGAGATGGGCGTT
AGTCTTGGGTCCGGAAAGGTCAAGACAATTGACCAGCGTGCCACGCTCCACCGCCGCACCACGCAGACTTATGGC
CTGAAACGCCCTACGTCGCGCAAAATTCTGTCTGAAGTGCAGAAGAAGTTTGGCACCTTTCCCTTTAGCCTGCGC
CAACTCGAGGATGAGCGTGATGCCAAGCTGGGAGTCGTCGAGTGCGTGCGCGGCAACGTGCTTCGCCAGTACGAG
CTGGTTGGCGACAAAGATAACGAGCCCGTCGCCCGCCTCTTGACAACGATTGCAATCACAAAGAATGGAATCACC
AAGCTCAGTGGCCCGCCCGCGCTGCAAGTGAGCCAGTACAAGACGGACAAGAAGATTACGGATCCAGAAATCCTC
AAGATGCTTGAGCAGCCACTGGCAAGGAATGCAGGCAAGAAGAAGAACAAGGGTAAAAAGAAGAAGAAGCCGGCC
AAGAAGGCGGCGACGGAAACTGCAGAGGTGGATTCGGAAGACGACTCGGACGACGACGAATAG
Gene >OphauG2|4523
ATGGCCGAGGAAAAAGATGTCGTTGGTAAGATGTCTTGGCTTCTTTGGCCTCTGTCTTGGAGCTTGAATTATCCC
TCCTTGTGCGCGCAAAAGCACTGCTGCTACCCCGCTGCTCACCCCGAGGTCATGCCATTTTGCTTACTGACAATT
GCCCTGTCCAAGACTACTCGCTCAACAATCCCGATACCCTCACCAAGTACAAGACTGCTGGTGCAATATCGGAAA
AGGTGCTGGCGGCTGTGTCAAAGCTCTGCGTGCCTGGAGACAAGATTGTCGACATTTGCCAAAAGGGCGACAAGC
TCATTGAGGAAGAGGTATCCAAGGTCTACCGCGGCAAAAAGGTCATCAAGGGTAAGCAGAAGCAGTCTTGCTGTT
GGCTGTGCAAAACCAGTTGACGCTTGACCCCCACAGGCTTCTCCCATCCAACCACGGTGTCGCCCTCGTCCTATG
TCACTCCATACACTCCCTTGACGTCGGACGAGAGTGAAGCTGCGCTCGAGATTCAAGCCGGCGAGGCCATCAAGA
TCCAACTCGGTGCCCAGATTGACGGCTTTGGCACCATTGTCTGCGACACCATCCTCGCACAGCCCGAGGACAAGG
CTGGCCAACAAGTCTCGGGCCGCGACGCAGACTTGATGCTGGCCACGCACTATGCAAATGAGCTGCTGCTGCGGT
TGATGCTGCCCTCTGGTCTGCTGGCGCAGGGCACCGACGAGGAAAAGGCAAAAGCAGCCGCGCAAAAGCCCCCTA
GCCAGGCCAAGATGACGAGTTTGCTGGAAAAGGTGTGCGAGAGCTTCGACTGCCACCTTGTCGAGAGCACTACCT
CATGGCTCTTTGACCATAACGAAATCGAGGGCTCCAAGAAGATTGTTCTTGCCCCTGCTGAAGGCTCCAAGGGCG
ATGGTGTGCCAGCCACAGCCGAGGTCTGGGGTGTCGAGATGGGCGTTAGTCTTGGGTCCGGAAAGGTCAAGACAA
TTGACCAGCGTGCCACGCTCCACCGCCGCACCACGCAGACTTATGGCCTGAAACGCCCTACGTCGCGCAAAATTC
TGTCTGAAGTGCAGAAGAAGTTTGGCACCTTTCCCTTTAGCCTGCGCCAACTCGAGGATGAGCGTGATGCCAAGC
TGGGAGTCGTCGAGTGCGTGCGCGGCAACGTGCTTCGCCAGTACGAGCTGGTTGGCGACAAAGATAACGAGCCCG
TCGCCCGCCTCTTGACAACGATTGGTGAGCATGACTTTGGAATTTTGCCCGTGCTGTGACATTTTGGCTAACAAG
GTCTCTCTCTACTCCCTCTACCTGTGCAGCAATCACAAAGAATGGAATCACCAAGCTCAGTGGCCCGCCCGCGCT
GCAAGTGAGCCAGTACAAGACGGACAAGAAGATTACGGATCCAGAAATCCTCAAGATGCTTGAGCAGCCACTGGC
AAGGAATGCAGGCAAGAAGAAGAACAAGGGTAAAAAGAAGAAGAAGCCGGCCAAGAAGGCGGCGACGGAAACTGC
AGAGGTGGATTCGGAAGACGACTCGGACGACGACGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail