Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4515
Gene name
LocationContig_380:5881..8037
Strand+
Gene length (bp)2156
Transcript length (bp)1968
Coding sequence length (bp)1968
Protein length (aa) 656

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10056 DUF2293 Uncharacterized conserved protein (DUF2293) 2.3E-24 197 285

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup922
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4515 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2427
Ophiocordyceps camponoti-floridani Ophcf2|01546
Ophiocordyceps camponoti-rufipedis Ophun1|2864
Ophiocordyceps kimflemingae Ophio5|1478
Ophiocordyceps subramaniannii Hirsu2|6381

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4515
MATDKQTSRSCTARRAYKGRRRKNKAQENAVSGASQLKTARPHSVAPPVSRHTTPRPITKVKHKVLFELVENREK
KKKLEFTTVRHKVPPPGYAFVACGNPELTTACKELSRDRGELMFIVSPQSLKLNGPHLGGSSRMNEQINRVGYHF
VATTVRDALASTSQPSAHLVPIQSEHTAPGLIPADAKVYLEQVEASFQELLPRMPNSDRQTIINSAFYWNPRRTP
VPPVGLQFQLPLTQRVHLATVAHIRHQHTEYDELLRNGSEKAFARTQVRSKCIDILVKWRGDDETGRDQFEEILR
EVIIISDTDDEDDHLDSLTDAMDTTMDDAQDYPPGLGALTPEPRGPIEESQSPGDRTCAKPGGSQRHGRRGFKRY
HAYEEAFRRQSESDAADSTPVLNVPTREKSVAERLATDRDQTMTFGSVGDTPTSNGFVRQAQHGQPLPGSDRLQD
MLVPSIEPPEAGLPAVADVLLDYSAHHGGPALFAERGFSSRSHRLPSRRVMSDQWPHRPCLSNFNETSGGLTRTE
PLIYSSAGCAREDAFPVPVPPAERLVMNVGRPGSRSNPIHMEDRGGFFEIVRNTPERESLELEMNGFVEVSRPMN
RTLQASERLPELLPRRDERQHGWSQSFMHRPGSGPVSISGAHGARALHHQTYWQT*
Coding >OphauG2|4515
ATGGCCACAGACAAGCAGACGTCTCGGTCCTGCACCGCTAGACGAGCCTACAAGGGCCGGCGCCGCAAGAACAAA
GCCCAAGAGAATGCCGTGAGCGGTGCCTCGCAACTCAAGACTGCACGGCCTCATAGTGTTGCGCCCCCAGTGTCG
AGACACACTACTCCCCGCCCCATCACAAAGGTCAAGCACAAGGTTTTGTTTGAGCTGGTTGAGAATCGAGAGAAA
AAAAAGAAGCTGGAATTCACCACGGTCCGACACAAAGTGCCCCCGCCCGGCTACGCATTCGTTGCCTGTGGTAAC
CCAGAGCTCACAACCGCCTGCAAAGAGCTCTCGAGGGATCGCGGAGAGCTCATGTTCATTGTCTCGCCGCAATCA
TTGAAGTTGAACGGCCCTCACCTTGGAGGCTCGTCGCGTATGAATGAACAAATAAACCGCGTCGGATACCACTTT
GTAGCCACCACTGTCCGCGACGCACTGGCAAGCACCAGTCAACCCTCTGCGCACTTGGTGCCTATTCAATCTGAG
CATACTGCCCCAGGCCTTATTCCTGCTGATGCCAAGGTCTATCTGGAACAAGTAGAGGCTTCTTTTCAAGAGCTC
CTTCCTCGAATGCCAAACAGCGACAGACAAACCATTATCAACTCGGCTTTCTATTGGAATCCCAGGCGAACTCCT
GTCCCACCAGTGGGTCTCCAATTTCAACTCCCCTTGACTCAAAGAGTCCACTTGGCCACAGTGGCCCACATTCGC
CACCAACACACTGAGTATGATGAGTTGCTTCGAAATGGCTCCGAAAAGGCTTTTGCCCGCACACAGGTCCGTAGC
AAATGCATCGACATCCTTGTCAAGTGGCGAGGCGATGATGAGACTGGCCGCGATCAATTCGAGGAAATCCTGCGC
GAGGTCATCATCATTTCAGATACTGATGACGAGGACGACCATCTTGACTCGCTGACTGATGCTATGGATACAACC
ATGGATGATGCTCAAGACTACCCCCCTGGTCTTGGAGCGCTGACTCCTGAGCCAAGAGGACCCATTGAAGAATCG
CAAAGTCCTGGAGATAGGACGTGTGCGAAACCTGGTGGTTCCCAAAGACATGGCCGCCGCGGATTCAAGAGATAT
CACGCCTATGAGGAGGCGTTCCGTCGCCAGAGTGAATCTGATGCTGCAGACTCAACCCCAGTATTAAATGTTCCC
ACGAGGGAGAAGAGCGTTGCCGAAAGGCTGGCCACTGATCGCGACCAAACCATGACCTTTGGCAGTGTTGGTGAT
ACCCCAACCTCCAACGGCTTTGTCCGCCAGGCTCAGCATGGACAGCCATTGCCAGGGTCTGATCGCCTTCAAGAC
ATGCTGGTCCCTTCGATAGAGCCTCCTGAAGCCGGTCTACCTGCAGTGGCAGATGTACTCCTTGACTACTCTGCG
CATCACGGTGGCCCAGCTTTATTTGCAGAGAGAGGGTTTAGTTCAAGGAGTCACAGGTTGCCCAGCCGTCGAGTG
ATGAGCGATCAGTGGCCTCATAGGCCATGCCTGTCCAATTTCAACGAGACGTCTGGTGGACTAACCCGGACGGAG
CCCCTTATTTATTCATCTGCAGGTTGTGCTCGCGAGGATGCTTTCCCTGTCCCCGTTCCCCCGGCTGAGAGACTT
GTAATGAATGTTGGCCGTCCGGGATCTAGATCAAATCCTATTCATATGGAAGACCGCGGCGGGTTTTTCGAGATT
GTGCGCAATACCCCGGAGCGCGAATCTTTGGAATTAGAAATGAATGGGTTTGTTGAAGTGTCGCGCCCGATGAAT
CGAACCTTGCAGGCATCGGAACGCCTTCCAGAATTGCTTCCCAGGCGCGACGAGAGGCAACATGGATGGTCTCAA
TCCTTTATGCACAGGCCTGGATCCGGCCCTGTCTCAATTTCCGGAGCCCATGGTGCTCGTGCGCTCCATCATCAG
ACCTATTGGCAAACGTGA
Transcript >OphauG2|4515
ATGGCCACAGACAAGCAGACGTCTCGGTCCTGCACCGCTAGACGAGCCTACAAGGGCCGGCGCCGCAAGAACAAA
GCCCAAGAGAATGCCGTGAGCGGTGCCTCGCAACTCAAGACTGCACGGCCTCATAGTGTTGCGCCCCCAGTGTCG
AGACACACTACTCCCCGCCCCATCACAAAGGTCAAGCACAAGGTTTTGTTTGAGCTGGTTGAGAATCGAGAGAAA
AAAAAGAAGCTGGAATTCACCACGGTCCGACACAAAGTGCCCCCGCCCGGCTACGCATTCGTTGCCTGTGGTAAC
CCAGAGCTCACAACCGCCTGCAAAGAGCTCTCGAGGGATCGCGGAGAGCTCATGTTCATTGTCTCGCCGCAATCA
TTGAAGTTGAACGGCCCTCACCTTGGAGGCTCGTCGCGTATGAATGAACAAATAAACCGCGTCGGATACCACTTT
GTAGCCACCACTGTCCGCGACGCACTGGCAAGCACCAGTCAACCCTCTGCGCACTTGGTGCCTATTCAATCTGAG
CATACTGCCCCAGGCCTTATTCCTGCTGATGCCAAGGTCTATCTGGAACAAGTAGAGGCTTCTTTTCAAGAGCTC
CTTCCTCGAATGCCAAACAGCGACAGACAAACCATTATCAACTCGGCTTTCTATTGGAATCCCAGGCGAACTCCT
GTCCCACCAGTGGGTCTCCAATTTCAACTCCCCTTGACTCAAAGAGTCCACTTGGCCACAGTGGCCCACATTCGC
CACCAACACACTGAGTATGATGAGTTGCTTCGAAATGGCTCCGAAAAGGCTTTTGCCCGCACACAGGTCCGTAGC
AAATGCATCGACATCCTTGTCAAGTGGCGAGGCGATGATGAGACTGGCCGCGATCAATTCGAGGAAATCCTGCGC
GAGGTCATCATCATTTCAGATACTGATGACGAGGACGACCATCTTGACTCGCTGACTGATGCTATGGATACAACC
ATGGATGATGCTCAAGACTACCCCCCTGGTCTTGGAGCGCTGACTCCTGAGCCAAGAGGACCCATTGAAGAATCG
CAAAGTCCTGGAGATAGGACGTGTGCGAAACCTGGTGGTTCCCAAAGACATGGCCGCCGCGGATTCAAGAGATAT
CACGCCTATGAGGAGGCGTTCCGTCGCCAGAGTGAATCTGATGCTGCAGACTCAACCCCAGTATTAAATGTTCCC
ACGAGGGAGAAGAGCGTTGCCGAAAGGCTGGCCACTGATCGCGACCAAACCATGACCTTTGGCAGTGTTGGTGAT
ACCCCAACCTCCAACGGCTTTGTCCGCCAGGCTCAGCATGGACAGCCATTGCCAGGGTCTGATCGCCTTCAAGAC
ATGCTGGTCCCTTCGATAGAGCCTCCTGAAGCCGGTCTACCTGCAGTGGCAGATGTACTCCTTGACTACTCTGCG
CATCACGGTGGCCCAGCTTTATTTGCAGAGAGAGGGTTTAGTTCAAGGAGTCACAGGTTGCCCAGCCGTCGAGTG
ATGAGCGATCAGTGGCCTCATAGGCCATGCCTGTCCAATTTCAACGAGACGTCTGGTGGACTAACCCGGACGGAG
CCCCTTATTTATTCATCTGCAGGTTGTGCTCGCGAGGATGCTTTCCCTGTCCCCGTTCCCCCGGCTGAGAGACTT
GTAATGAATGTTGGCCGTCCGGGATCTAGATCAAATCCTATTCATATGGAAGACCGCGGCGGGTTTTTCGAGATT
GTGCGCAATACCCCGGAGCGCGAATCTTTGGAATTAGAAATGAATGGGTTTGTTGAAGTGTCGCGCCCGATGAAT
CGAACCTTGCAGGCATCGGAACGCCTTCCAGAATTGCTTCCCAGGCGCGACGAGAGGCAACATGGATGGTCTCAA
TCCTTTATGCACAGGCCTGGATCCGGCCCTGTCTCAATTTCCGGAGCCCATGGTGCTCGTGCGCTCCATCATCAG
ACCTATTGGCAAACGTGA
Gene >OphauG2|4515
ATGGCCACAGACAAGCAGACGTCTCGGTCCTGCACCGCTAGACGAGCCTACAAGGGCCGGCGCCGCAAGAACAAA
GCCCAAGAGAATGCCGTGAGCGGTGCCTCGCAACTCAAGACTGCACGGCCTCATAGTGTTGCGCCCCCAGTGTCG
AGACACACTACTCCCCGCCCCATCACAAAGGTCAAGCACAAGGTTTTGTTTGAGCTGGTTGAGAATCGAGAGAAA
AAAAAGAAGCTGGAATTCACCGTAGGCTCCAATAAGATGCGCCCTTGGCTTCAAAATACACCCCTTCTTTTCCCA
TGGCTGACTGGCCGCCCATAGACGGTCCGACACAAAGTGCCCCCGCCCGGCTACGCATTCGTTGCCTGTGGTAAC
CCAGAGCTCACAACCGCCTGCAAAGAGCTCTCGAGGGATCGCGGAGAGCTCATGTTCATTGTCTCGGTACGACTC
TTCGCGTCCTCTGCCCCCAACCCTTGGTCAATTTGATGCTCAACATTTGCAGCCGCAATCATTGAAGTTGAACGG
CCCTCACCTTGGAGGCTCGTCGCGTATGAATGAACAAATAAACCGCGTCGGATACCACTTTGTAGCCACCACTGT
CCGCGACGCACTGGCAAGCACCAGTCAACCCTCTGCGCACTTGGTGCCTATTCAATCTGAGCATACTGCCCCAGG
CCTTATTCCTGCTGATGCCAAGGTCTATCTGGAACAAGTAGAGGCTTCTTTTCAAGAGCTCCTTCCTCGAATGCC
AAACAGCGACAGACAAACCATTATCAACTCGGCTTTCTATTGGGCAAGTTGTATTGCATCATCAAACTTGTTTCA
CCCACTGACTTCAGGTGCAGAATCCCAGGCGAACTCCTGTCCCACCAGTGGGTCTCCAATTTCAACTCCCCTTGA
CTCAAAGAGTCCACTTGGCCACAGTGGCCCACATTCGCCACCAACACACTGAGTATGATGAGTTGCTTCGAAATG
GCTCCGAAAAGGCTTTTGCCCGCACACAGGTCCGTAGCAAATGCATCGACATCCTTGTCAAGTGGCGAGGCGATG
ATGAGACTGGCCGCGATCAATTCGAGGAAATCCTGCGCGAGGTCATCATCATTTCAGATACTGATGACGAGGACG
ACCATCTTGACTCGCTGACTGATGCTATGGATACAACCATGGATGATGCTCAAGACTACCCCCCTGGTCTTGGAG
CGCTGACTCCTGAGCCAAGAGGACCCATTGAAGAATCGCAAAGTCCTGGAGATAGGACGTGTGCGAAACCTGGTG
GTTCCCAAAGACATGGCCGCCGCGGATTCAAGAGATATCACGCCTATGAGGAGGCGTTCCGTCGCCAGAGTGAAT
CTGATGCTGCAGACTCAACCCCAGTATTAAATGTTCCCACGAGGGAGAAGAGCGTTGCCGAAAGGCTGGCCACTG
ATCGCGACCAAACCATGACCTTTGGCAGTGTTGGTGATACCCCAACCTCCAACGGCTTTGTCCGCCAGGCTCAGC
ATGGACAGCCATTGCCAGGGTCTGATCGCCTTCAAGACATGCTGGTCCCTTCGATAGAGCCTCCTGAAGCCGGTC
TACCTGCAGTGGCAGATGTACTCCTTGACTACTCTGCGCATCACGGTGGCCCAGCTTTATTTGCAGAGAGAGGGT
TTAGTTCAAGGAGTCACAGGTTGCCCAGCCGTCGAGTGATGAGCGATCAGTGGCCTCATAGGCCATGCCTGTCCA
ATTTCAACGAGACGTCTGGTGGACTAACCCGGACGGAGCCCCTTATTTATTCATCTGCAGGTTGTGCTCGCGAGG
ATGCTTTCCCTGTCCCCGTTCCCCCGGCTGAGAGACTTGTAATGAATGTTGGCCGTCCGGGATCTAGATCAAATC
CTATTCATATGGAAGACCGCGGCGGGTTTTTCGAGATTGTGCGCAATACCCCGGAGCGCGAATCTTTGGAATTAG
AAATGAATGGGTTTGTTGAAGTGTCGCGCCCGATGAATCGAACCTTGCAGGCATCGGAACGCCTTCCAGAATTGC
TTCCCAGGCGCGACGAGAGGCAACATGGATGGTCTCAATCCTTTATGCACAGGCCTGGATCCGGCCCTGTCTCAA
TTTCCGGAGCCCATGGTGCTCGTGCGCTCCATCATCAGACCTATTGGCAAACGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail