Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4512
Gene name
LocationContig_38:43755..45700
Strand+
Gene length (bp)1945
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20463 PDH_C Prephenate dehydrogenase, dimerization domain 4.3E-06 166 265
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 2.0E-05 5 111
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 2.5E-04 5 86

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60078|TYR1_SCHPO Probable prephenate dehydrogenase [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyr1 PE=2 SV=1 2 449 1.0E-173
sp|P20049|TYR1_YEAST Prephenate dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYR1 PE=1 SV=2 5 450 1.0E-164
sp|Q58029|Y612_METJA Probable arogenate/prephenate dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0612 PE=3 SV=1 3 263 3.0E-17

GO

GO Term Description Terminal node
GO:0050661 NADP binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4512
MQDFTVGLIGMGDMGKMYAERLSAAGWRLLACDREDRYDDLKKKYAGTVNLEICRNGHLVSRASDFILYSVEAAL
IGGVIAQYGPSTKMGAIVGGQTSCKSPEIEAFEAHLPADVSIVSCHSLHGPSVDPRNQPLVLIQHRASDEALQKV
EAVLTCLGSKYVYLTAQEHDRITADTQAVTHAAFLSMGKAWHANRQFPWELSRYVGGIENVKINTTLRIYSQKWH
VYAGVAILNPEARKQIAQYAESVTQLYKLMLEGDIKGLRERVYLAREKVFGYASSSLSSSTTGEMAATSDNQSPT
WTSRPLIEPDILSSFSLGIPTNDCVSRPNNHLSLLAMVDCWAALGIVPYEHMLCSTPLFRLRLGVTEHLFRDSRL
LDETIHTAVYDKTYRSDDLEFTFAARGWAECVSLGHFETWKTRFISTQQFFEPRFEEAKTVGDKMMKKILQSTKD
T*
Coding >OphauG2|4512
ATGCAAGACTTCACCGTCGGCTTGATTGGCATGGGAGACATGGGCAAGATGTATGCCGAGCGGCTTTCTGCTGCT
GGCTGGAGGCTTCTAGCCTGCGATAGAGAAGATAGATACGATGACCTCAAAAAGAAATATGCTGGCACAGTTAAC
CTAGAAATCTGTCGCAACGGCCACCTTGTATCCCGTGCTAGCGACTTCATTCTGTACAGCGTCGAGGCTGCTCTA
ATAGGAGGCGTTATTGCCCAATATGGACCATCTACTAAGATGGGCGCCATTGTCGGTGGTCAGACTTCGTGCAAG
TCTCCCGAGATTGAAGCCTTCGAGGCACACCTTCCCGCCGACGTATCCATTGTCTCATGCCACTCACTGCATGGA
CCCAGCGTCGACCCGCGCAACCAGCCGCTCGTCCTCATCCAGCATCGAGCTTCAGACGAGGCGTTGCAAAAGGTG
GAGGCGGTACTGACATGTCTGGGCTCCAAATATGTTTATCTGACGGCCCAGGAACACGACCGCATCACAGCTGAC
ACGCAAGCCGTCACCCATGCTGCCTTTCTTTCAATGGGCAAGGCCTGGCACGCCAACCGCCAGTTTCCCTGGGAA
CTAAGCCGCTATGTTGGCGGTATCGAAAATGTCAAAATCAACACCACCTTACGAATATATAGCCAGAAGTGGCAC
GTCTACGCCGGTGTCGCAATTTTAAACCCAGAGGCAAGAAAGCAGATCGCCCAGTATGCCGAGAGTGTCACTCAA
CTCTATAAGCTCATGCTCGAGGGAGACATTAAGGGCCTTCGTGAGCGAGTCTACCTGGCCCGTGAAAAGGTCTTT
GGTTATGCTTCGTCGTCTTTGTCGTCTTCTACCACTGGAGAGATGGCTGCTACTAGCGACAACCAATCTCCGACC
TGGACCTCGCGGCCTCTAATTGAGCCCGATATCTTGTCCTCCTTCTCGCTCGGCATTCCTACCAACGACTGTGTC
TCGAGGCCCAATAATCACCTTTCTCTGCTTGCCATGGTTGATTGCTGGGCTGCACTCGGAATTGTTCCCTATGAA
CACATGCTATGTAGCACGCCTCTTTTCCGCCTTCGCCTTGGCGTAACGGAGCACCTATTTCGAGACTCTCGCCTC
CTCGATGAGACTATACACACTGCCGTATACGACAAGACGTACCGCAGTGACGATCTTGAGTTTACATTTGCCGCT
CGTGGCTGGGCAGAATGCGTGTCACTCGGCCACTTCGAAACCTGGAAGACGCGCTTTATCAGTACCCAACAATTT
TTTGAGCCTCGGTTCGAAGAGGCTAAGACTGTTGGTGATAAGATGATGAAAAAAATACTACAAAGCACAAAAGAC
ACTTGA
Transcript >OphauG2|4512
ATGCAAGACTTCACCGTCGGCTTGATTGGCATGGGAGACATGGGCAAGATGTATGCCGAGCGGCTTTCTGCTGCT
GGCTGGAGGCTTCTAGCCTGCGATAGAGAAGATAGATACGATGACCTCAAAAAGAAATATGCTGGCACAGTTAAC
CTAGAAATCTGTCGCAACGGCCACCTTGTATCCCGTGCTAGCGACTTCATTCTGTACAGCGTCGAGGCTGCTCTA
ATAGGAGGCGTTATTGCCCAATATGGACCATCTACTAAGATGGGCGCCATTGTCGGTGGTCAGACTTCGTGCAAG
TCTCCCGAGATTGAAGCCTTCGAGGCACACCTTCCCGCCGACGTATCCATTGTCTCATGCCACTCACTGCATGGA
CCCAGCGTCGACCCGCGCAACCAGCCGCTCGTCCTCATCCAGCATCGAGCTTCAGACGAGGCGTTGCAAAAGGTG
GAGGCGGTACTGACATGTCTGGGCTCCAAATATGTTTATCTGACGGCCCAGGAACACGACCGCATCACAGCTGAC
ACGCAAGCCGTCACCCATGCTGCCTTTCTTTCAATGGGCAAGGCCTGGCACGCCAACCGCCAGTTTCCCTGGGAA
CTAAGCCGCTATGTTGGCGGTATCGAAAATGTCAAAATCAACACCACCTTACGAATATATAGCCAGAAGTGGCAC
GTCTACGCCGGTGTCGCAATTTTAAACCCAGAGGCAAGAAAGCAGATCGCCCAGTATGCCGAGAGTGTCACTCAA
CTCTATAAGCTCATGCTCGAGGGAGACATTAAGGGCCTTCGTGAGCGAGTCTACCTGGCCCGTGAAAAGGTCTTT
GGTTATGCTTCGTCGTCTTTGTCGTCTTCTACCACTGGAGAGATGGCTGCTACTAGCGACAACCAATCTCCGACC
TGGACCTCGCGGCCTCTAATTGAGCCCGATATCTTGTCCTCCTTCTCGCTCGGCATTCCTACCAACGACTGTGTC
TCGAGGCCCAATAATCACCTTTCTCTGCTTGCCATGGTTGATTGCTGGGCTGCACTCGGAATTGTTCCCTATGAA
CACATGCTATGTAGCACGCCTCTTTTCCGCCTTCGCCTTGGCGTAACGGAGCACCTATTTCGAGACTCTCGCCTC
CTCGATGAGACTATACACACTGCCGTATACGACAAGACGTACCGCAGTGACGATCTTGAGTTTACATTTGCCGCT
CGTGGCTGGGCAGAATGCGTGTCACTCGGCCACTTCGAAACCTGGAAGACGCGCTTTATCAGTACCCAACAATTT
TTTGAGCCTCGGTTCGAAGAGGCTAAGACTGTTGGTGATAAGATGATGAAAAAAATACTACAAAGCACAAAAGAC
ACTTGA
Gene >OphauG2|4512
ATGCAAGACTTCACCGTCGGCTTGATTGGCATGGGAGACATGGGCAAGATGTATGCCGAGCGGCTTTCTGCTGCT
GGCTGGAGGTGAGTTGCTACCACTGGTGGCGGCCCTTTGATGCCATGGTGAGTTCTTCTTGGCCACTTCTTCTTT
TTTCTCTCCCATTTTCCTCCATAATGATGACTAGAGCGCATTTGGCTCGAGTATTGTCCAGGGGCTGCCTGGGGT
CCGTTCCGGCGCTCAGGCTTTGTCCCTGGCTTTCGTTGATGAAAATGCTAGCTACCTTTTCATATCATTTGTCTG
ATTGAGCACCTTGTGCAAATTTGATGATTTCACGCTCGACTGCTTCTCGAACTTGTTCTGGATGCTGACGATTGT
CGTTTTAGATCCCGTGAAAAAACGAATGAATGACATATGCCGACAGCTTTGTGCACAAAACAGGCTTCTAGCCTG
CGATAGAGAAGATAGATACGATGACCTCAAAAAGAAATATGCTGGCACAGTACGACTGCCCCACATCTTCGTTCT
GCTTGCCTGCTCCTCGACTCTGCTGCCTTGTTGTGCTTCTCTTGTCTGCTGCATGGGCCATATTTAAACAATACT
TAGCAACACTTACTGAATGGTGCTCTTGTCAGGTTAACCTAGAAATCTGTCGCAACGGCCACCTTGTATCCCGTG
CTAGCGACTTCATTCTGTACAGCGTCGAGGCTGCTCTAATAGGAGGCGTTATTGCCCAATATGGACCATGTATGA
TGAGCCAGCCTCGCCTTTTATCTCGTGCCCATTGCCCTTGATGCGGCCTCCCCTCCTAGTTACCGATCAATTCTC
ATGACAAACCGTGCACACAGCTACTAAGATGGGCGCCATTGTCGGTGGTCAGACTTCGTGCAAGTCTCCCGAGAT
TGAAGCCTTCGAGGCACACCTTCCCGCCGACGTATCCATTGTCTCATGCCACTCACTGCATGGACCCAGCGTCGA
CCCGCGCAACCAGCCGCTCGTCCTCATCCAGCATCGAGCTTCAGACGAGGCGTTGCAAAAGGTGGAGGCGGTACT
GACATGTCTGGGCTCCAAATATGTTTATCTGACGGCCCAGGAACACGACCGCATCACAGCTGACACGCAAGCCGT
CACCCATGCTGCCTTTCTTTCAATGGGCAAGGCCTGGCACGCCAACCGCCAGTTTCCCTGGGAACTAAGCCGCTA
TGTTGGCGGTATCGAAAATGTCAAAATCAACACCACCTTACGAATATATAGCCAGAAGTGGCACGTCTACGCCGG
TGTCGCAATTTTAAACCCAGAGGCAAGAAAGCAGATCGCCCAGTATGCCGAGAGTGTCACTCAACTCTATAAGCT
CATGCTCGAGGGAGACATTAAGGGCCTTCGTGAGCGAGTCTACCTGGCCCGTGAAAAGGTCTTTGGTTATGCTTC
GTCGTCTTTGTCGTCTTCTACCACTGGAGAGATGGCTGCTACTAGCGACAACCAATCTCCGACCTGGACCTCGCG
GCCTCTAATTGAGCCCGATATCTTGTCCTCCTTCTCGCTCGGCATTCCTACCAACGACTGTGTCTCGAGGCCCAA
TAATCACCTTTCTCTGCTTGCCATGGTTGATTGCTGGGCTGCACTCGGAATTGTTCCCTATGAACACATGCTATG
TAGCACGCCTCTTTTCCGCCTTCGCCTTGGCGTAACGGAGCACCTATTTCGAGACTCTCGCCTCCTCGATGAGAC
TATACACACTGCCGTATACGACAAGACGTACCGCAGTGACGATCTTGAGTTTACATTTGCCGCTCGTGGCTGGGC
AGAATGCGTGTCACTCGGCCACTTCGAAACCTGGAAGACGCGCTTTATCAGTACCCAACAATTTTTTGAGCCTCG
GTTCGAAGAGGCTAAGACTGTTGGTGATAAGATGATGAAAAAAATACTACAAAGCACAAAAGACACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail