Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4511
Gene name
LocationContig_38:40212..42531
Strand-
Gene length (bp)2319
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4988
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4511 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03893
Ophiocordyceps camponoti-rufipedis Ophun1|4837
Ophiocordyceps kimflemingae Ophio5|7202
Ophiocordyceps subramaniannii Hirsu2|2274
Ophiocordyceps subramaniannii Hirsu2|256

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4511
MCPYSVLPYSPRVRTIQVMEPPSSYEALRELHSDLSRKYKIHKTAIERIWRSLDGPQRAKCFKAGAADGVVLQHP
ADTSMGNVYKIMPEMNLRDIAKPGSDFLLRLLKHRATLPLSEQYCTGVDGDLGDHGLIAKMMTEKGLRHVDDYKD
CYTMFYDDKIYGESVKLVSHRAESLAGLAPAIRAQVVVPQSMGELILQRQIYIIQGLNIFIEDILEAGSENRNQR
PAPKKPANPASQALPRLTSIKGQPKPTILDISTNANEQRLSLEDYLDLMLTEPLVLTQVVNIRFFSQPELVADEK
GRRLPVHTDKHISPVLYEAMQDAIRGVSIWSYINFLLKHLQNPVLDKAYRMIVQQELVNAYHIEYARSQSNLKRF
VQIDSGNKWFKRISNARGKTGDARVTLKGNVQDLFGVDTQLYYILRLCQPETSPAKAIEWIGKLSDLHRNHPDEQ
EKLGSTETDALGDLAVILAFIQDVTSMTSLPPFSRKTGQILADNLQKLDLQVTQLQANVDLGDFVIPIDHLLEDG
MASGALTAMDEYLCNTLGTTMRAAYQNMISECTAELAKRYQQVKARIDQNDAKPPPFSSTTELATPPTQPRHVKE
KTRGVEPAMVMYTTDASTPMAINDDAHPPTLQVNSTIARVFRTIFRKSEARGSVTWDAFEAAMASLGFSVIPKCG
SIFTFLPPSTMSVKKSITIHRPHKSQIEGYRLLLIGKRLGRIYGWNDETFQEA*
Coding >OphauG2|4511
ATGTGTCCGTACTCTGTACTTCCTTACTCTCCTCGAGTCAGAACAATCCAAGTCATGGAGCCGCCCTCGAGCTAT
GAAGCCCTTAGAGAGCTCCATAGCGATCTATCGAGGAAATACAAGATTCACAAGACAGCCATCGAACGCATTTGG
CGCTCTCTAGATGGACCCCAGCGGGCCAAGTGCTTTAAAGCAGGCGCAGCTGACGGCGTCGTCCTACAACACCCA
GCTGACACGTCTATGGGAAATGTGTATAAAATCATGCCAGAGATGAATCTTCGTGATATTGCGAAGCCAGGGTCG
GACTTCTTGCTGCGCCTTCTAAAGCATCGGGCTACGCTTCCTCTCTCAGAACAATATTGCACTGGAGTCGACGGA
GACTTGGGCGATCATGGCTTGATTGCCAAGATGATGACTGAAAAAGGGCTGCGCCATGTTGACGACTACAAGGAC
TGTTACACCATGTTTTACGACGACAAAATATATGGGGAGTCCGTTAAACTCGTGTCTCATCGTGCCGAGTCTTTG
GCTGGATTGGCGCCGGCGATTCGCGCTCAGGTGGTTGTCCCACAATCTATGGGCGAGTTGATTCTCCAAAGGCAA
ATCTATATCATACAGGGGCTCAATATATTTATCGAGGACATATTGGAGGCAGGTTCAGAAAACAGAAACCAAAGA
CCTGCTCCCAAGAAACCCGCCAATCCTGCGTCACAGGCACTTCCCCGGCTTACTTCCATTAAAGGGCAGCCTAAA
CCGACAATCTTAGACATCTCTACCAATGCGAACGAGCAACGACTATCTCTCGAGGACTATCTAGACCTCATGTTG
ACTGAGCCTCTTGTTCTCACTCAAGTGGTCAATATACGATTTTTCAGTCAGCCAGAGCTTGTGGCTGATGAGAAA
GGTCGAAGGCTTCCCGTCCACACAGACAAACACATCAGCCCAGTGCTTTACGAGGCGATGCAAGACGCAATCAGA
GGGGTTTCCATATGGTCTTACATCAACTTTCTCTTAAAGCACCTACAGAATCCTGTCCTGGATAAAGCCTACCGC
ATGATTGTCCAACAGGAGTTGGTCAACGCCTACCATATTGAATATGCTCGGTCGCAGAGTAATCTCAAGCGATTT
GTGCAGATAGACTCTGGCAACAAATGGTTTAAAAGGATATCAAATGCCCGAGGTAAAACCGGTGATGCACGTGTC
ACTCTCAAGGGGAATGTCCAAGACTTGTTTGGCGTGGACACTCAGCTGTATTATATCCTACGACTTTGTCAACCC
GAGACTAGTCCTGCCAAGGCCATCGAATGGATTGGCAAACTCAGCGACCTGCACCGAAACCACCCAGACGAGCAG
GAGAAGCTTGGATCGACAGAGACTGACGCGCTTGGAGATCTGGCAGTCATCCTCGCATTCATCCAAGACGTTACA
TCTATGACGTCGCTACCACCCTTCTCCCGTAAAACGGGACAAATTTTGGCGGACAATTTGCAAAAGCTGGATCTC
CAAGTTACTCAACTACAGGCGAATGTCGATTTGGGCGATTTCGTCATCCCAATTGACCATTTACTTGAGGACGGG
ATGGCCTCGGGGGCCTTGACGGCAATGGATGAGTATCTGTGCAACACACTTGGAACAACCATGCGTGCTGCCTAT
CAGAACATGATATCGGAATGTACCGCCGAACTCGCCAAGCGATACCAACAAGTCAAGGCGCGAATAGACCAAAAT
GATGCAAAACCTCCCCCATTTTCTTCAACAACGGAGTTGGCAACCCCCCCGACTCAACCACGACACGTAAAGGAG
AAGACGCGCGGTGTCGAACCAGCTATGGTTATGTACACGACAGATGCATCAACACCAATGGCTATAAACGATGAC
GCCCATCCACCGACGCTCCAAGTCAACTCGACAATTGCCCGAGTCTTCAGGACCATCTTCAGAAAGTCCGAAGCG
CGTGGGTCGGTGACCTGGGATGCTTTTGAGGCAGCCATGGCCAGTTTGGGCTTCTCTGTTATACCCAAGTGTGGC
TCAATTTTCACCTTTCTTCCTCCAAGCACAATGTCCGTGAAAAAATCCATTACGATTCATAGGCCACACAAATCC
CAGATAGAGGGCTACAGATTGCTACTGATTGGAAAACGGCTAGGCCGTATCTATGGATGGAATGATGAGACATTT
CAGGAGGCTTAG
Transcript >OphauG2|4511
ATGTGTCCGTACTCTGTACTTCCTTACTCTCCTCGAGTCAGAACAATCCAAGTCATGGAGCCGCCCTCGAGCTAT
GAAGCCCTTAGAGAGCTCCATAGCGATCTATCGAGGAAATACAAGATTCACAAGACAGCCATCGAACGCATTTGG
CGCTCTCTAGATGGACCCCAGCGGGCCAAGTGCTTTAAAGCAGGCGCAGCTGACGGCGTCGTCCTACAACACCCA
GCTGACACGTCTATGGGAAATGTGTATAAAATCATGCCAGAGATGAATCTTCGTGATATTGCGAAGCCAGGGTCG
GACTTCTTGCTGCGCCTTCTAAAGCATCGGGCTACGCTTCCTCTCTCAGAACAATATTGCACTGGAGTCGACGGA
GACTTGGGCGATCATGGCTTGATTGCCAAGATGATGACTGAAAAAGGGCTGCGCCATGTTGACGACTACAAGGAC
TGTTACACCATGTTTTACGACGACAAAATATATGGGGAGTCCGTTAAACTCGTGTCTCATCGTGCCGAGTCTTTG
GCTGGATTGGCGCCGGCGATTCGCGCTCAGGTGGTTGTCCCACAATCTATGGGCGAGTTGATTCTCCAAAGGCAA
ATCTATATCATACAGGGGCTCAATATATTTATCGAGGACATATTGGAGGCAGGTTCAGAAAACAGAAACCAAAGA
CCTGCTCCCAAGAAACCCGCCAATCCTGCGTCACAGGCACTTCCCCGGCTTACTTCCATTAAAGGGCAGCCTAAA
CCGACAATCTTAGACATCTCTACCAATGCGAACGAGCAACGACTATCTCTCGAGGACTATCTAGACCTCATGTTG
ACTGAGCCTCTTGTTCTCACTCAAGTGGTCAATATACGATTTTTCAGTCAGCCAGAGCTTGTGGCTGATGAGAAA
GGTCGAAGGCTTCCCGTCCACACAGACAAACACATCAGCCCAGTGCTTTACGAGGCGATGCAAGACGCAATCAGA
GGGGTTTCCATATGGTCTTACATCAACTTTCTCTTAAAGCACCTACAGAATCCTGTCCTGGATAAAGCCTACCGC
ATGATTGTCCAACAGGAGTTGGTCAACGCCTACCATATTGAATATGCTCGGTCGCAGAGTAATCTCAAGCGATTT
GTGCAGATAGACTCTGGCAACAAATGGTTTAAAAGGATATCAAATGCCCGAGGTAAAACCGGTGATGCACGTGTC
ACTCTCAAGGGGAATGTCCAAGACTTGTTTGGCGTGGACACTCAGCTGTATTATATCCTACGACTTTGTCAACCC
GAGACTAGTCCTGCCAAGGCCATCGAATGGATTGGCAAACTCAGCGACCTGCACCGAAACCACCCAGACGAGCAG
GAGAAGCTTGGATCGACAGAGACTGACGCGCTTGGAGATCTGGCAGTCATCCTCGCATTCATCCAAGACGTTACA
TCTATGACGTCGCTACCACCCTTCTCCCGTAAAACGGGACAAATTTTGGCGGACAATTTGCAAAAGCTGGATCTC
CAAGTTACTCAACTACAGGCGAATGTCGATTTGGGCGATTTCGTCATCCCAATTGACCATTTACTTGAGGACGGG
ATGGCCTCGGGGGCCTTGACGGCAATGGATGAGTATCTGTGCAACACACTTGGAACAACCATGCGTGCTGCCTAT
CAGAACATGATATCGGAATGTACCGCCGAACTCGCCAAGCGATACCAACAAGTCAAGGCGCGAATAGACCAAAAT
GATGCAAAACCTCCCCCATTTTCTTCAACAACGGAGTTGGCAACCCCCCCGACTCAACCACGACACGTAAAGGAG
AAGACGCGCGGTGTCGAACCAGCTATGGTTATGTACACGACAGATGCATCAACACCAATGGCTATAAACGATGAC
GCCCATCCACCGACGCTCCAAGTCAACTCGACAATTGCCCGAGTCTTCAGGACCATCTTCAGAAAGTCCGAAGCG
CGTGGGTCGGTGACCTGGGATGCTTTTGAGGCAGCCATGGCCAGTTTGGGCTTCTCTGTTATACCCAAGTGTGGC
TCAATTTTCACCTTTCTTCCTCCAAGCACAATGTCCGTGAAAAAATCCATTACGATTCATAGGCCACACAAATCC
CAGATAGAGGGCTACAGATTGCTACTGATTGGAAAACGGCTAGGCCGTATCTATGGATGGAATGATGAGACATTT
CAGGAGGCTTAG
Gene >OphauG2|4511
ATGTGTCCGTACTCTGTACTTCCTTACTCTGTAGGTCAAGCTACAAGGGTCTAATCCGTACAGAGCATAATCCTC
TTTATTAAATCGTATACGCCCACAAACTCTCATAGCCTCGAGGTAAGGTTTTGCATCGTCAAGCTTTCTTCACAA
CACTGACAGCCTCTCACAGTCAGAACAATCCAAGTCATGGAGCCGCCCTCGAGCTATGAAGCCCTTAGAGAGCTC
CATAGCGATCTATCGAGGAAATACAAGATTCACAAGACAGCCATCGAACGCATTTGGCGCTCTCTAGATGGACCC
CAGCGGGCCAAGTGCTTTAAAGCAGGCGCAGCTGACGGCGTCGTCCTACAACACCCAGCTGACACGTCTATGGGA
AATGTGTATAAAATCATGCCAGAGATGAATCTTCGTGATATTGCGAAGCCAGGGTCGGACTTCTTGCTGCGCCTT
CTAAAGCATCGGGCTACGCTTCCTCTCTCAGAACAATATTGCACTGGAGTCGACGGAGACTTGGGCGATCATGGC
TTGATTGCCAAGATGATGACTGAAAAAGGGCTGCGCCATGTTGACGACTACAAGGACTGTTACACCATGTTTTAC
GACGACAAAATATATGGGGAGTCCGTTAAACTCGTGTCTCATCGTGCCGAGTCTTTGGCTGGATTGGCGCCGGCG
ATTCGCGCTCAGGTGGTTGTCCCACAATCTATGGGCGAGTTGATTCTCCAAAGGCAAATCTATATCATACAGGGG
CTCAATATATTTATCGAGGACATATTGGAGGCAGGTTCAGAAAACAGAAACCAAAGACCTGCTCCCAAGAAACCC
GCCAATCCTGCGTCACAGGCACTTCCCCGGCTTACTTCCATTAAAGGGCAGCCTAAACCGACAATCTTAGACATC
TCTACCAATGCGAACGAGCAACGACTATCTCTCGAGGACTATCTAGACCTCATGTTGACTGAGCCTCTTGTTCTC
ACTCAAGTGGTCAATATACGATTTTTCAGTCAGCCAGAGCTTGTGGCTGATGAGAAAGGTCGAAGGCTTCCCGTC
CACACAGACAAACACATCAGCCCAGTGCTTTACGAGGCGATGCAAGACGCAATCAGAGGGGTTTCCATATGGTCT
TACATCAACTTTCTCTTAAAGCACCTACAGAATCCTGTCCTGGATAAAGCCTACCGCATGATTGTCCAACAGGAG
TTGGTCAACGCCTACCATATTGAATATGCTCGGTCGCAGAGTAATCTCAAGCGATTTGTGCAGATAGACTCTGGC
AACAAATGGTTTAAAAGGATATCAAATGCCCGAGGTAAAACCGGTGATGCACGTGTCACTCTCAAGGGGAATGTC
CAAGACTTGTTTGGCGTGGACACTCAGCTGTATTATATCCTACGACTTTGTCAACCCGAGACTAGTCCTGCCAAG
GCCATCGAATGGATTGGCAAACTCAGCGACCTGCACCGAAACCACCCAGACGAGCAGGAGAAGCTTGGATCGACA
GAGACTGACGCGCTTGGAGATCTGGCAGTCATCCTCGCATTCATCCAAGACGTTACATCTATGACGTCGCTACCA
CCCTTCTCCCGTAAAACGGGACAAATTTTGGCGGACAATTTGCAAAAGCTGGATCTCCAAGTTACTCAACTACAG
GCGAATGTCGATTTGGGCGATTTCGTCATCCCAATTGACCATTTACTTGAGGACGGGATGGCCTCGGGGGCCTTG
ACGGCAATGGATGAGTATCTGTGCAACACACTTGGAACAACCATGCGTGCTGCCTATCAGAACATGATATCGGAA
TGTACCGCCGAACTCGCCAAGCGATACCAACAAGTCAAGGCGCGAATAGACCAAAATGATGCAAAACCTCCCCCA
TTTTCTTCAACAACGGAGTTGGCAACCCCCCCGACTCAACCACGACACGTAAAGGAGAAGACGCGCGGTGTCGAA
CCAGCTATGGTTATGTACACGACAGATGCATCAACACCAATGGCTATAAACGATGACGCCCATCCACCGACGCTC
CAAGTCAACTCGACAATTGCCCGAGTCTTCAGGACCATCTTCAGAAAGTCCGAAGCGCGTGGGTCGGTGACCTGG
GATGCTTTTGAGGCAGCCATGGCCAGTTTGGGCTTCTCTGTTATACCCAAGTGTGGCTCAATTTTCACCTTTCTT
CCTCCAAGCACAATGTCCGTGAAAAAATCCATTACGATTCATAGGCCACACAAATCCCAGATAGAGGGCTACAGA
TTGCTACTGATTGGAAAACGGCTAGGCCGTATCTATGGATGGAATGATGAGACATTTCAGGAGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail