Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|45
Gene name
LocationContig_1:107236..108900
Strand+
Gene length (bp)1664
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02214 BTB_2 BTB/POZ domain 1.1E-04 41 134

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03900|YD132_YEAST Uncharacterized protein YDR132C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR132C PE=1 SV=1 29 329 9.0E-48
sp|Q12259|YL108_YEAST BTB/POZ domain-containing protein YLR108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR108C PE=1 SV=1 24 332 5.0E-36
sp|A3KMV1|SHKB1_BOVIN SH3KBP1-binding protein 1 OS=Bos taurus GN=SHKBP1 PE=2 SV=1 29 191 2.0E-06
sp|Q8TBC3|SHKB1_HUMAN SH3KBP1-binding protein 1 OS=Homo sapiens GN=SHKBP1 PE=1 SV=2 29 191 2.0E-06

GO

GO Term Description Terminal node
GO:0051260 protein homooligomerization Yes
GO:0016043 cellular component organization No
GO:0043933 protein-containing complex organization No
GO:0051259 protein complex oligomerization No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0022607 cellular component assembly No
GO:0065003 protein-containing complex assembly No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5065
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|45 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1585
Ophiocordyceps camponoti-floridani Ophcf2|05746
Ophiocordyceps kimflemingae Ophio5|2083
Ophiocordyceps subramaniannii Hirsu2|286

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|45
MASASPSDGSTPAAALAMRQPSEKTLAKIPEILPHGRVFPIQIGGEMFKLSGASLSSDAPSYFSQYFLCQIKTAE
ENGEEPCASLRTLYIDRDPATFSDIALHLQGYHVTPRDGTHFVRLFADAQFYSLPKLMSQLFEESIFISIGHREF
QIPRDLLTSPTNSPNYFSLGFAAFFSRPDNMFPGLDREGLIRPPAIRPPSVPNRSADTFAALLRLLRGYPVHIRD
EAHRQELLRDARYFHFKGLEQQLIPHSISYNLMRQRDEIVLRLENVQKSGVSIARDGEAEPQPQPQYQQQHQHAF
AAWVNYARPYVDDRPAELVLEIGGETTRVHFGPDGPRAEFFRDTKARVAKLLEVIATKLSLPPTTQPLGLLMATG
GAGSQPATPGNTPLSDDLVRVTLGPDAAVVVDGKPLSTSQVDVVDAADVAAAADASQGLRKRRRTDDGAADETWI
VKTGQWRLRLQSSKSGKSSVECVLVAVRIDAVSSELGRNMARGFLTV*
Coding >OphauG2|45
ATGGCGTCTGCAAGTCCGAGCGACGGCTCCACGCCTGCGGCCGCCTTGGCCATGAGGCAGCCTTCGGAGAAGACA
CTGGCCAAGATTCCCGAAATTCTTCCCCACGGCCGCGTATTTCCAATCCAGATTGGCGGCGAGATGTTTAAGCTC
TCGGGCGCGTCGCTGAGCTCCGATGCTCCCTCATACTTTTCTCAGTATTTCCTCTGTCAGATCAAGACGGCCGAG
GAAAACGGCGAGGAGCCCTGTGCCTCGCTTCGAACCCTATACATTGATCGCGATCCAGCCACCTTTTCCGACATT
GCTCTGCATCTCCAAGGCTACCACGTCACCCCCCGCGATGGCACGCACTTTGTGCGTCTTTTTGCCGATGCCCAG
TTCTACAGCCTTCCCAAGCTCATGTCGCAACTCTTTGAGGAGAGCATCTTCATATCCATTGGCCACCGCGAATTT
CAGATTCCTCGCGATCTCTTGACCAGTCCCACCAACTCGCCAAACTACTTTTCTCTGGGCTTTGCTGCCTTCTTC
TCACGTCCCGACAATATGTTTCCTGGACTCGACCGCGAAGGCCTGATTCGTCCTCCCGCCATTCGCCCGCCCTCA
GTTCCCAACAGATCTGCCGATACCTTTGCCGCCCTGTTGCGCCTATTGCGCGGATACCCTGTTCATATACGCGAC
GAGGCCCACCGCCAAGAGCTGCTGCGCGACGCCAGATACTTCCACTTCAAGGGCCTTGAGCAGCAGCTCATCCCC
CACAGTATTAGCTACAATCTGATGCGCCAGCGTGACGAGATTGTGCTCCGGCTCGAAAACGTGCAAAAGAGCGGT
GTCAGCATTGCCCGCGACGGCGAGGCTGAGCCTCAGCCCCAGCCTCAGTACCAACAGCAGCATCAGCACGCCTTT
GCCGCCTGGGTCAACTATGCGCGGCCATATGTCGACGATCGGCCAGCAGAACTAGTGCTTGAAATAGGCGGCGAG
ACAACACGGGTCCACTTTGGGCCCGACGGGCCTCGCGCCGAGTTTTTTCGCGACACAAAGGCTCGCGTCGCCAAG
CTGCTCGAAGTAATAGCCACCAAGCTGAGCTTGCCGCCCACGACACAGCCTCTCGGCCTGCTCATGGCTACCGGC
GGCGCCGGCTCTCAGCCTGCTACACCAGGAAACACGCCCTTGAGCGATGACCTGGTCCGTGTTACCCTGGGTCCC
GATGCGGCAGTCGTTGTTGATGGAAAGCCCCTGTCGACGAGCCAAGTTGACGTGGTAGATGCCGCCGACGTGGCT
GCTGCTGCCGATGCGAGCCAAGGCTTGCGCAAGCGCCGCCGCACCGACGATGGCGCCGCTGACGAGACGTGGATC
GTCAAGACGGGCCAGTGGCGCCTGCGGCTCCAGTCCAGCAAAAGTGGCAAAAGCTCTGTCGAATGTGTCCTCGTT
GCTGTTCGTATAGATGCCGTCAGCTCCGAGCTGGGCCGCAACATGGCCAGAGGCTTCCTCACTGTTTGA
Transcript >OphauG2|45
ATGGCGTCTGCAAGTCCGAGCGACGGCTCCACGCCTGCGGCCGCCTTGGCCATGAGGCAGCCTTCGGAGAAGACA
CTGGCCAAGATTCCCGAAATTCTTCCCCACGGCCGCGTATTTCCAATCCAGATTGGCGGCGAGATGTTTAAGCTC
TCGGGCGCGTCGCTGAGCTCCGATGCTCCCTCATACTTTTCTCAGTATTTCCTCTGTCAGATCAAGACGGCCGAG
GAAAACGGCGAGGAGCCCTGTGCCTCGCTTCGAACCCTATACATTGATCGCGATCCAGCCACCTTTTCCGACATT
GCTCTGCATCTCCAAGGCTACCACGTCACCCCCCGCGATGGCACGCACTTTGTGCGTCTTTTTGCCGATGCCCAG
TTCTACAGCCTTCCCAAGCTCATGTCGCAACTCTTTGAGGAGAGCATCTTCATATCCATTGGCCACCGCGAATTT
CAGATTCCTCGCGATCTCTTGACCAGTCCCACCAACTCGCCAAACTACTTTTCTCTGGGCTTTGCTGCCTTCTTC
TCACGTCCCGACAATATGTTTCCTGGACTCGACCGCGAAGGCCTGATTCGTCCTCCCGCCATTCGCCCGCCCTCA
GTTCCCAACAGATCTGCCGATACCTTTGCCGCCCTGTTGCGCCTATTGCGCGGATACCCTGTTCATATACGCGAC
GAGGCCCACCGCCAAGAGCTGCTGCGCGACGCCAGATACTTCCACTTCAAGGGCCTTGAGCAGCAGCTCATCCCC
CACAGTATTAGCTACAATCTGATGCGCCAGCGTGACGAGATTGTGCTCCGGCTCGAAAACGTGCAAAAGAGCGGT
GTCAGCATTGCCCGCGACGGCGAGGCTGAGCCTCAGCCCCAGCCTCAGTACCAACAGCAGCATCAGCACGCCTTT
GCCGCCTGGGTCAACTATGCGCGGCCATATGTCGACGATCGGCCAGCAGAACTAGTGCTTGAAATAGGCGGCGAG
ACAACACGGGTCCACTTTGGGCCCGACGGGCCTCGCGCCGAGTTTTTTCGCGACACAAAGGCTCGCGTCGCCAAG
CTGCTCGAAGTAATAGCCACCAAGCTGAGCTTGCCGCCCACGACACAGCCTCTCGGCCTGCTCATGGCTACCGGC
GGCGCCGGCTCTCAGCCTGCTACACCAGGAAACACGCCCTTGAGCGATGACCTGGTCCGTGTTACCCTGGGTCCC
GATGCGGCAGTCGTTGTTGATGGAAAGCCCCTGTCGACGAGCCAAGTTGACGTGGTAGATGCCGCCGACGTGGCT
GCTGCTGCCGATGCGAGCCAAGGCTTGCGCAAGCGCCGCCGCACCGACGATGGCGCCGCTGACGAGACGTGGATC
GTCAAGACGGGCCAGTGGCGCCTGCGGCTCCAGTCCAGCAAAAGTGGCAAAAGCTCTGTCGAATGTGTCCTCGTT
GCTGTTCGTATAGATGCCGTCAGCTCCGAGCTGGGCCGCAACATGGCCAGAGGCTTCCTCACTGTTTGA
Gene >OphauG2|45
ATGGCGTCTGCAAGTCCGAGCGACGGCTCCACGCCTGCGGCCGCCTTGGCCATGAGGCAGCCTTCGGAGAAGACA
CTGGCCAAGATTCCCGAAATTCTTCCCCACGGCCGCGTATTTCCAATCCAGATTGGCGGCGAGATGTTTAAGCTC
TCGGGCGCGTCGCTGAGCTCCGATGGTTGGTGCCCGCGCTTCTATGCCTTGGCGCCTGTCGTTTCCTGCTCCCCG
CTGTCCCCTCTCGCATCTGGCCTCACTTTGCGCCGCTAACTCGCTGCCTAGCTCCCTCATACTTTTCTCAGTATT
TCCTCTGTCAGATCAAGACGGCCGAGGAAAACGGCGAGGAGCCCTGTGCCTCGCTTCGAACCCTATACATTGATC
GCGATCCAGCCACCTTTTCCGACATTGCTCTGCATCTCCAAGGCTACCACGTCACCCCCCGCGATGGCACGCACT
TTGTGCGTCTTTTTGCCGATGCCCAGTTCTACAGCCGTATAGCAGCTCCCCTACGGCCTCGAGTCACGTCAAACC
AGAATGGTTCACGCTGACCAGGCGGTCTAGTTCCCAAGCTCATGTCGCAACTCTTTGAGGAGAGCATCTTCATAT
CCATTGGCCACCGCGAATTTCAGATTCCTCGCGATCTCTTGACCAGTCCCACCAACTCGCCAAACTACTTTTCTC
TGGGCTTTGCTGCCTTCTTCTCACGTCCCGACAATATGTTTCCTGGACTCGACCGCGAAGGCCTGATTCGTCCTC
CCGCCATTCGCCCGCCCTCAGTTCCCAACAGATCTGCCGATACCTTTGCCGCCCTGTTGCGCCTATTGCGCGGAT
ACCCTGTTCATATACGCGACGAGGCCCACCGCCAAGAGCTGCTGCGCGACGCCAGATACTTCCACTTCAAGGGCC
TTGAGCAGCAGCTCATCCCCCACAGTATTAGCTACAATCTGATGCGCCAGCGTGACGAGATTGTGCTCCGGCTCG
AAAACGTGCAAAAGAGCGGTGTCAGCATTGCCCGCGACGGCGAGGCTGAGCCTCAGCCCCAGCCTCAGTACCAAC
AGCAGCATCAGCACGCCTTTGCCGCCTGGGTCAACTATGCGCGGCCATATGTCGACGATCGGCCAGCAGAACTAG
TGCTTGAAATAGGCGGCGAGACAACACGGGTCCACTTTGGGCCCGACGGGCCTCGCGCCGAGTTTTTTCGCGACA
CAAAGGCTCGCGTCGCCAAGCTGCTCGAAGTAATAGCCACCAAGCTGAGCTTGCCGCCCACGACACAGCCTCTCG
GCCTGCTCATGGCTACCGGCGGCGCCGGCTCTCAGCCTGCTACACCAGGAAACACGCCCTTGAGCGATGACCTGG
TCCGTGTTACCCTGGGTCCCGATGCGGCAGTCGTTGTTGATGGAAAGCCCCTGTCGACGAGCCAAGTTGACGTGG
TAGATGCCGCCGACGTGGCTGCTGCTGCCGATGCGAGCCAAGGCTTGCGCAAGCGCCGCCGCACCGACGATGGCG
CCGCTGACGAGACGTGGATCGTCAAGACGGGCCAGTGGCGCCTGCGGCTCCAGTCCAGCAAAAGTGGCAAAAGCT
CTGTCGAATGTGTCCTCGTTGCTGTTCGTATAGATGCCGTCAGCTCCGAGCTGGGCCGCAACATGGCCAGAGGCT
TCCTCACTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail