Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4495
Gene name
LocationContig_379:5383..8523
Strand+
Gene length (bp)3140
Transcript length (bp)2721
Coding sequence length (bp)2721
Protein length (aa) 907

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13892 DBINO DNA-binding domain 7.7E-49 690 821

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 74 869 0.0E+00
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 99 874 2.0E-173
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 35 873 9.0E-161
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 365 874 2.0E-129
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 412 874 4.0E-88
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 74 869 0.0E+00
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 99 874 2.0E-173
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 35 873 9.0E-161
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 365 874 2.0E-129
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 412 874 4.0E-88
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 162 874 8.0E-88
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 172 874 8.0E-87
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 172 874 1.0E-85
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 417 874 3.0E-81
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 411 874 1.0E-80
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 192 874 2.0E-80
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 350 874 5.0E-79
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 184 874 6.0E-77
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 625 873 7.0E-42
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 689 873 9.0E-40
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 681 873 9.0E-40
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 681 825 9.0E-38
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 689 873 1.0E-37
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 681 880 2.0E-37
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 681 880 6.0E-37
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 681 873 2.0E-36
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 645 819 4.0E-35
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 689 873 2.0E-34
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 693 820 2.0E-33
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 692 825 3.0E-20
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 692 825 3.0E-20
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 696 819 7.0E-18
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 695 818 9.0E-18
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 695 818 1.0E-17
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 653 818 1.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4495
MDSNFRLLQRPHGDDDDGLARQREANTSPSGLRGDFHHPQAPHHAASHPSPFSSSTLDSSRIGHGIPSPTRQHPP
PLHRHQNHHTSPYMAASSARGTAAESSLPPPSGMASSASSNHNTTPSHRQHQPPSPRHAHAFYDYPRREKSASGS
FYDPTTDTTKVSDSWRNNSTAPQASTPKSYYNGSYSPPRLSSYASRPRSPVSHSHPVLPADSLSPPARRPRMPSP
TPRPGANASNGSSAIKSEPLAPPSSNLAPPSTSTSRPADPMSFSNILSCSEPGPKPAEKASLSNLVEPKLEPEAE
PEPDTEVDKDNETETEPTPGSKKSEIVVKKKGTRKSAKGRASDIRDAEAPKSKRKSSSSAKKESPAPRTSTKRMA
NGQPKPKTTLSTDTERRIHNFEMQIDHDASKLDPSEFDQDDYEARAEKRLCTMVDRENERNYHRRQDYAENACKK
LNSHSDLGKRRYDDVFYDEALHEVREQELFAEKERKKDMQRKRRREKSMAITIEAKEAALARALAAPDEEERQKH
LRDAERANKKAEQTKLILQKGIKGPARNIELIPDGGTMSSLLTSDADTPKHPKARGKHNRPKKSKEQKQAEKESA
EAAQALLDAGYELPPREESKVRIKIKGRSKDKDKSHNVDADEPEKGKEKEKSKSKEKGESQKSKKEKDPEQEAKD
EAAELEKRFSSKGYNQIYEQIWRDMARKDVSKTFKLAVDSYATKGSNLKKTAILASKEAKRWQLRTNKGTKDLQA
RAKRVMRDMMSFWKRNEREERDLRKAAEKQELENARREEADREAARQKRKLNFLISQTELYSHFVGKKIKTDEVE
RSTDNPDVAPEARKSIKPDSKLDVDEPSGPMSNKVTDFANLDFDNEDESKEGARLQQPRAGHGRGGRDELSEPNR
AWRRGD*
Coding >OphauG2|4495
ATGGACAGCAATTTTCGCCTGCTGCAGCGGCCGCACGGGGACGACGACGACGGGCTGGCCCGGCAGCGCGAGGCA
AACACATCGCCGTCGGGCCTGCGCGGCGACTTCCATCATCCCCAGGCGCCTCACCACGCCGCCTCGCACCCGTCG
CCCTTCTCGTCGTCGACGCTCGACAGCAGCCGTATTGGGCATGGCATCCCGTCGCCGACGCGCCAGCACCCGCCG
CCGCTGCATCGCCACCAGAACCACCACACTAGCCCCTACATGGCCGCCTCGTCTGCTCGCGGCACCGCTGCTGAG
AGTTCGCTGCCGCCGCCTTCCGGAATGGCCTCATCCGCCTCGTCCAATCACAACACCACGCCCAGCCATCGACAG
CACCAGCCGCCATCGCCGCGTCACGCTCACGCCTTTTACGATTACCCTAGACGAGAAAAATCAGCGTCGGGCAGC
TTCTACGACCCCACGACCGACACCACCAAGGTCTCAGACTCATGGCGCAACAACAGCACCGCGCCCCAGGCCTCC
ACGCCAAAGTCATACTACAACGGCTCCTACTCCCCCCCCCGGCTCTCTTCCTACGCCTCCCGTCCACGCAGCCCT
GTTTCCCATTCCCATCCCGTCCTCCCTGCCGACTCCCTTAGCCCGCCCGCTCGCCGCCCTCGCATGCCTTCGCCA
ACACCACGGCCTGGCGCCAACGCGTCCAACGGCTCCTCGGCTATCAAGTCGGAGCCGTTGGCTCCGCCATCATCC
AATCTCGCTCCTCCATCAACTTCTACCAGCCGCCCTGCCGACCCCATGTCCTTTTCCAACATTCTCTCCTGCTCC
GAGCCCGGGCCCAAGCCCGCCGAAAAAGCTTCTCTCTCCAATCTTGTAGAGCCCAAGCTGGAACCCGAAGCCGAG
CCCGAGCCTGATACCGAGGTAGACAAGGATAATGAGACCGAAACAGAACCCACTCCCGGCTCCAAGAAGAGCGAG
ATAGTCGTCAAGAAGAAGGGGACGCGAAAGTCTGCCAAGGGTAGGGCTTCTGACATCAGGGATGCCGAAGCTCCC
AAGTCGAAGCGCAAGTCGTCGTCGTCGGCCAAGAAGGAGTCTCCTGCGCCTCGCACTTCCACCAAGCGCATGGCC
AATGGTCAACCCAAGCCCAAGACCACCCTGTCCACAGACACTGAGAGGAGAATTCACAATTTCGAGATGCAGATT
GACCACGACGCTTCAAAATTGGATCCATCCGAGTTTGACCAAGACGACTATGAGGCTCGAGCAGAGAAGCGCCTT
TGCACCATGGTCGACAGGGAGAATGAGCGCAACTACCATCGTCGCCAAGACTATGCCGAAAATGCTTGCAAAAAG
CTCAACAGTCACTCGGATCTCGGAAAGCGCCGGTATGATGATGTTTTTTACGACGAAGCTCTTCATGAAGTTAGG
GAACAGGAGCTCTTTGCCGAAAAGGAGCGCAAAAAGGACATGCAGCGCAAACGCCGCCGTGAAAAGTCAATGGCC
ATTACCATTGAAGCAAAGGAGGCCGCTCTGGCCCGCGCACTCGCCGCTCCCGACGAGGAAGAGCGCCAGAAGCAT
CTGCGTGATGCTGAGCGTGCCAACAAAAAGGCCGAGCAGACCAAACTCATTCTCCAAAAAGGCATCAAGGGCCCA
GCTCGTAACATTGAGCTCATTCCAGACGGCGGCACCATGTCGAGTCTTTTGACATCTGATGCCGACACCCCCAAG
CATCCCAAGGCTCGAGGCAAGCACAACCGTCCTAAAAAGTCCAAGGAGCAGAAGCAGGCCGAGAAGGAGTCTGCC
GAAGCCGCCCAGGCTCTTCTCGATGCTGGCTACGAGTTGCCCCCCAGAGAGGAGAGCAAGGTGCGAATCAAGATC
AAGGGGCGTTCCAAGGACAAGGACAAGAGCCACAACGTCGATGCAGACGAGCCGGAAAAGGGCAAGGAAAAGGAA
AAGTCCAAGTCCAAGGAAAAGGGCGAGTCCCAAAAATCCAAAAAGGAAAAGGACCCGGAGCAGGAAGCCAAGGAC
GAAGCCGCCGAACTTGAAAAGCGATTCTCCTCAAAGGGCTACAACCAAATCTATGAGCAGATTTGGCGCGACATG
GCTCGCAAAGACGTTAGCAAGACGTTCAAACTCGCTGTTGACTCATATGCCACAAAGGGCTCGAATCTTAAAAAG
ACTGCCATTCTGGCCTCCAAGGAAGCAAAGAGGTGGCAACTTCGCACCAACAAGGGCACCAAGGACCTTCAGGCG
AGAGCCAAACGCGTCATGCGTGACATGATGAGCTTTTGGAAGCGTAACGAACGGGAGGAGCGTGATTTGCGCAAG
GCGGCGGAAAAGCAGGAGCTGGAAAATGCCCGGCGAGAAGAGGCGGACCGAGAAGCGGCGCGTCAGAAGAGGAAG
CTCAATTTCCTCATTTCTCAGACTGAACTCTACTCGCACTTTGTCGGCAAGAAGATCAAGACGGACGAGGTTGAG
CGGAGCACCGACAACCCCGACGTGGCTCCAGAAGCCCGCAAGAGCATCAAGCCGGACAGCAAGCTGGATGTTGAT
GAACCGTCGGGGCCAATGAGCAACAAGGTGACCGACTTTGCCAACCTCGACTTTGACAATGAGGACGAGAGCAAA
GAAGGCGCGAGACTTCAACAACCAAGGGCTGGACATGGACGAGGAGGGCGAGATGAACTTTCAGAACCCAACCGG
GCTTGGCGACGTGGAGATTGA
Transcript >OphauG2|4495
ATGGACAGCAATTTTCGCCTGCTGCAGCGGCCGCACGGGGACGACGACGACGGGCTGGCCCGGCAGCGCGAGGCA
AACACATCGCCGTCGGGCCTGCGCGGCGACTTCCATCATCCCCAGGCGCCTCACCACGCCGCCTCGCACCCGTCG
CCCTTCTCGTCGTCGACGCTCGACAGCAGCCGTATTGGGCATGGCATCCCGTCGCCGACGCGCCAGCACCCGCCG
CCGCTGCATCGCCACCAGAACCACCACACTAGCCCCTACATGGCCGCCTCGTCTGCTCGCGGCACCGCTGCTGAG
AGTTCGCTGCCGCCGCCTTCCGGAATGGCCTCATCCGCCTCGTCCAATCACAACACCACGCCCAGCCATCGACAG
CACCAGCCGCCATCGCCGCGTCACGCTCACGCCTTTTACGATTACCCTAGACGAGAAAAATCAGCGTCGGGCAGC
TTCTACGACCCCACGACCGACACCACCAAGGTCTCAGACTCATGGCGCAACAACAGCACCGCGCCCCAGGCCTCC
ACGCCAAAGTCATACTACAACGGCTCCTACTCCCCCCCCCGGCTCTCTTCCTACGCCTCCCGTCCACGCAGCCCT
GTTTCCCATTCCCATCCCGTCCTCCCTGCCGACTCCCTTAGCCCGCCCGCTCGCCGCCCTCGCATGCCTTCGCCA
ACACCACGGCCTGGCGCCAACGCGTCCAACGGCTCCTCGGCTATCAAGTCGGAGCCGTTGGCTCCGCCATCATCC
AATCTCGCTCCTCCATCAACTTCTACCAGCCGCCCTGCCGACCCCATGTCCTTTTCCAACATTCTCTCCTGCTCC
GAGCCCGGGCCCAAGCCCGCCGAAAAAGCTTCTCTCTCCAATCTTGTAGAGCCCAAGCTGGAACCCGAAGCCGAG
CCCGAGCCTGATACCGAGGTAGACAAGGATAATGAGACCGAAACAGAACCCACTCCCGGCTCCAAGAAGAGCGAG
ATAGTCGTCAAGAAGAAGGGGACGCGAAAGTCTGCCAAGGGTAGGGCTTCTGACATCAGGGATGCCGAAGCTCCC
AAGTCGAAGCGCAAGTCGTCGTCGTCGGCCAAGAAGGAGTCTCCTGCGCCTCGCACTTCCACCAAGCGCATGGCC
AATGGTCAACCCAAGCCCAAGACCACCCTGTCCACAGACACTGAGAGGAGAATTCACAATTTCGAGATGCAGATT
GACCACGACGCTTCAAAATTGGATCCATCCGAGTTTGACCAAGACGACTATGAGGCTCGAGCAGAGAAGCGCCTT
TGCACCATGGTCGACAGGGAGAATGAGCGCAACTACCATCGTCGCCAAGACTATGCCGAAAATGCTTGCAAAAAG
CTCAACAGTCACTCGGATCTCGGAAAGCGCCGGTATGATGATGTTTTTTACGACGAAGCTCTTCATGAAGTTAGG
GAACAGGAGCTCTTTGCCGAAAAGGAGCGCAAAAAGGACATGCAGCGCAAACGCCGCCGTGAAAAGTCAATGGCC
ATTACCATTGAAGCAAAGGAGGCCGCTCTGGCCCGCGCACTCGCCGCTCCCGACGAGGAAGAGCGCCAGAAGCAT
CTGCGTGATGCTGAGCGTGCCAACAAAAAGGCCGAGCAGACCAAACTCATTCTCCAAAAAGGCATCAAGGGCCCA
GCTCGTAACATTGAGCTCATTCCAGACGGCGGCACCATGTCGAGTCTTTTGACATCTGATGCCGACACCCCCAAG
CATCCCAAGGCTCGAGGCAAGCACAACCGTCCTAAAAAGTCCAAGGAGCAGAAGCAGGCCGAGAAGGAGTCTGCC
GAAGCCGCCCAGGCTCTTCTCGATGCTGGCTACGAGTTGCCCCCCAGAGAGGAGAGCAAGGTGCGAATCAAGATC
AAGGGGCGTTCCAAGGACAAGGACAAGAGCCACAACGTCGATGCAGACGAGCCGGAAAAGGGCAAGGAAAAGGAA
AAGTCCAAGTCCAAGGAAAAGGGCGAGTCCCAAAAATCCAAAAAGGAAAAGGACCCGGAGCAGGAAGCCAAGGAC
GAAGCCGCCGAACTTGAAAAGCGATTCTCCTCAAAGGGCTACAACCAAATCTATGAGCAGATTTGGCGCGACATG
GCTCGCAAAGACGTTAGCAAGACGTTCAAACTCGCTGTTGACTCATATGCCACAAAGGGCTCGAATCTTAAAAAG
ACTGCCATTCTGGCCTCCAAGGAAGCAAAGAGGTGGCAACTTCGCACCAACAAGGGCACCAAGGACCTTCAGGCG
AGAGCCAAACGCGTCATGCGTGACATGATGAGCTTTTGGAAGCGTAACGAACGGGAGGAGCGTGATTTGCGCAAG
GCGGCGGAAAAGCAGGAGCTGGAAAATGCCCGGCGAGAAGAGGCGGACCGAGAAGCGGCGCGTCAGAAGAGGAAG
CTCAATTTCCTCATTTCTCAGACTGAACTCTACTCGCACTTTGTCGGCAAGAAGATCAAGACGGACGAGGTTGAG
CGGAGCACCGACAACCCCGACGTGGCTCCAGAAGCCCGCAAGAGCATCAAGCCGGACAGCAAGCTGGATGTTGAT
GAACCGTCGGGGCCAATGAGCAACAAGGTGACCGACTTTGCCAACCTCGACTTTGACAATGAGGACGAGAGCAAA
GAAGGCGCGAGACTTCAACAACCAAGGGCTGGACATGGACGAGGAGGGCGAGATGAACTTTCAGAACCCAACCGG
GCTTGGCGACGTGGAGATTGA
Gene >OphauG2|4495
ATGGACAGCAATTTTCGCCTGCTGCAGCGGCCGCACGGGGACGACGACGACGGGCTGGCCCGGCAGCGCGAGGCA
AACACATCGCCGTCGGGCCTGCGCGGCGACTTCCATCATCCCCAGGCGCCTCACCACGCCGCCTCGCACCCGTCG
CCCTTCTCGTCGTCGACGCTCGACAGCAGCCGTATTGGGCATGGCATCCCGTCGCCGACGCGCCAGCACCCGCCG
CCGCTGCATCGCCACCAGAACCACCACACTAGCCCCTACATGGCCGCCTCGTCTGCTCGCGGCACCGCTGCTGAG
AGTTCGCTGCCGCCGCCTTCCGGAATGGCCTCATCCGCCTCGTCCAATCACAACACCACGCCCAGCCATCGACAG
CACCAGCCGCCATCGCCGCGTCACGCTCACGCCTTTTACGATTACCCTAGACGAGAAAAATCAGCGTCGGGCAGC
TTCTACGACCCCACGACCGACACCACCAAGGTCTCAGACTCATGGCGCAACAACAGCACCGCGCCCCAGGCCTCC
ACGCCAAAGGTAAGCCCGCCCCCGTAGTCCACTTCTTTTTTTTAACCACTCCCACGCACCAACTTGGCTTTTTCC
CACGCCAAAAAATTTCCATCTCGCCACAACACTTGCTCACCCGCCATGCACCCTCGCCCCCATAATAAATCTCCC
CCTCAGTCTCCCCCTCTGCCGGCCCTTGCACCTCGCTCCTCTCATGGCAGACTGCAATTCTGACGCGCCCATTTT
GGTTTTTAGCATCCCCCTCGCCATCCCTACTCCTCCTACCCCCCCGCGCCTACTGACAAGCACCAGTCATACTAC
AACGGCTCCTACTCCCCCCCCCGGCTCTCTTCCTACGCCTCCCGTCCACGCAGCCCTGTTTCCCATTCCCATCCC
GTCCTCCCTGCCGACTCCCTTAGCCCGCCCGCTCGCCGCCCTCGCATGCCTTCGCCAACACCACGGCCTGGCGCC
AACGCGTCCAACGGCTCCTCGGCTATCAAGTCGGAGCCGTTGGCTCCGCCATCATCCAATCTCGCTCCTCCATCA
ACTGTAAGCTGCCAGCTGTCAGCCCCTACCAAAAAAAAAAAAAAAACAGAGAACCCTACTACCTTCTTTCAAGCT
GACACCTGCCAGTCTACCAGCCGCCCTGCCGACCCCATGTCCTTTTCCAACATTCTCTCCTGCTCCGAGCCCGGG
CCCAAGCCCGCCGAAAAAGCTTCTCTCTCCAATCTTGTAGAGCCCAAGCTGGAACCCGAAGCCGAGCCCGAGCCT
GATACCGAGGTAGACAAGGATAATGAGACCGAAACAGAACCCACTCCCGGCTCCAAGAAGAGCGAGATAGTCGTC
AAGAAGAAGGGGACGCGAAAGTCTGCCAAGGGTAGGGCTTCTGACATCAGGGATGCCGAAGCTCCCAAGTCGAAG
CGCAAGTCGTCGTCGTCGGCCAAGAAGGAGTCTCCTGCGCCTCGCACTTCCACCAAGCGCATGGCCAATGGTCAA
CCCAAGCCCAAGACCACCCTGTCCACAGACACTGAGAGGAGAATTCACAATTTCGAGATGCAGATTGACCACGAC
GCTTCAAAATTGGATCCATCCGAGTTTGACCAAGACGACTATGAGGCTCGAGCAGAGAAGCGCCTTTGCACCATG
GTCGACAGGGAGAATGAGCGCAACTACCATCGTCGCCAAGACTATGCCGAAAATGCTTGCAAAAAGCTCAACAGT
CACTCGGATCTCGGAAAGCGCCGGTATGATGATGTTTTTTACGACGAAGCTCTTCATGAAGTTAGGGAACAGGAG
CTCTTTGCCGAAAAGGAGCGCAAAAAGGACATGCAGCGCAAACGCCGCCGTGAAAAGTCAATGGCCATTACCATT
GAAGCAAAGGAGGCCGCTCTGGCCCGCGCACTCGCCGCTCCCGACGAGGAAGAGCGCCAGAAGCATCTGCGTGAT
GCTGAGCGTGCCAACAAAAAGGCCGAGCAGACCAAACTCATTCTCCAAAAAGGCATCAAGGGCCCAGCTCGTAAC
ATTGAGCTCATTCCAGACGGCGGCACCATGTCGAGTCTTTTGACATCTGATGCCGACACCCCCAAGCATCCCAAG
GCTCGAGGCAAGCACAACCGTCCTAAAAAGTCCAAGGAGCAGAAGCAGGCCGAGAAGGAGTCTGCCGAAGCCGCC
CAGGCTCTTCTCGATGCTGGCTACGAGTTGCCCCCCAGAGAGGAGAGCAAGGTGCGAATCAAGATCAAGGGGCGT
TCCAAGGACAAGGACAAGAGCCACAACGTCGATGCAGACGAGCCGGAAAAGGGCAAGGAAAAGGAAAAGTCCAAG
TCCAAGGAAAAGGGCGAGTCCCAAAAATCCAAAAAGGAAAAGGACCCGGAGCAGGAAGCCAAGGACGAAGCCGCC
GAACTTGAAAAGCGATTCTCCTCAAAGGGCTACAACCAAATCTATGAGCAGATTTGGCGCGACATGGCTCGCAAA
GACGTTAGCAAGACGTTCAAACTCGCTGTTGACTCATATGCCACAAAGGGCTCGAATCTTAAAAAGACTGCCATT
CTGGCCTCCAAGGAAGCAAAGAGGTGGCAACTTCGCACCAACAAGGGCACCAAGGACCTTCAGGCGAGAGCCAAA
CGCGTCATGCGTGACATGATGAGCTTTTGGAAGCGTAACGAACGGGAGGAGCGTGATTTGCGCAAGGCGGCGGAA
AAGCAGGAGCTGGAAAATGCCCGGCGAGAAGAGGCGGACCGAGAAGCGGCGCGTCAGAAGAGGAAGCTCAATTTC
CTCATTTCTCAGACTGAACTCTACTCGCACTTTGTCGGCAAGAAGATCAAGACGGACGAGGTTGAGCGGAGCACC
GACAACCCCGACGTGGCTCCAGAAGCCCGCAAGAGCATCAAGCCGGACAGCAAGCTGGATGTTGATGAACCGTCG
GGGCCAATGAGCAACAAGGTGACCGACTTTGCCAACCTCGACTTTGACAATGAGGACGAGAGCAGTCTGCGTGCG
GCGGCCATGGCCAATGCGCAAAACGCCATTGCCGAGGCGCAGAAGAAGGCGCGAGACTTCAACAACCAAGGGCTG
GACATGGACGAGGAGGGCGAGATGAACTTTCAGAACCCAACCGGGCTTGGCGACGTGGAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail