Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4485
Gene name
LocationContig_377:3560..10130
Strand-
Gene length (bp)6570
Transcript length (bp)6450
Coding sequence length (bp)6450
Protein length (aa) 2150

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13329 ATG2_CAD Autophagy-related protein 2 CAD motif 4.7E-40 1283 1447
PF09333 ATG_C Autophagy-related protein C terminal domain 6.4E-31 2053 2148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6R6E3|ATG2_AJECN Autophagy-related protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG2 PE=3 SV=1 5 2148 0.0E+00
sp|A7KAL3|ATG2_PENRW Autophagy-related protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg2 PE=3 SV=1 455 2148 0.0E+00
sp|Q5B1T9|ATG2_EMENI Autophagy-related protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg2 PE=3 SV=2 454 2148 0.0E+00
sp|Q4WLK5|ATG2_ASPFU Autophagy-related protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg2 PE=3 SV=1 455 2145 0.0E+00
sp|A1DP40|ATG2_NEOFI Autophagy-related protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg2 PE=3 SV=1 1563 2148 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6R6E3|ATG2_AJECN Autophagy-related protein 2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG2 PE=3 SV=1 5 2148 0.0E+00
sp|A7KAL3|ATG2_PENRW Autophagy-related protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg2 PE=3 SV=1 455 2148 0.0E+00
sp|Q5B1T9|ATG2_EMENI Autophagy-related protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg2 PE=3 SV=2 454 2148 0.0E+00
sp|Q4WLK5|ATG2_ASPFU Autophagy-related protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg2 PE=3 SV=1 455 2145 0.0E+00
sp|A1DP40|ATG2_NEOFI Autophagy-related protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg2 PE=3 SV=1 1563 2148 0.0E+00
sp|Q0CSI0|ATG2_ASPTN Autophagy-related protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg2 PE=3 SV=1 455 2148 0.0E+00
sp|Q2ULE1|ATG2_ASPOR Autophagy-related protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg2 PE=3 SV=1 452 2148 0.0E+00
sp|A2QSC9|ATG2_ASPNC Autophagy-related protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg2 PE=3 SV=1 455 2145 0.0E+00
sp|Q2GYD8|ATG2_CHAGB Autophagy-related protein 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG2 PE=3 SV=1 1 2148 0.0E+00
sp|A6S7C7|ATG2_BOTFB Autophagy-related protein 2 OS=Botryotinia fuckeliana (strain B05.10) GN=atg2 PE=3 SV=1 455 2148 0.0E+00
sp|Q1E702|ATG2_COCIM Autophagy-related protein 2 OS=Coccidioides immitis (strain RS) GN=ATG2 PE=3 SV=1 15 2148 0.0E+00
sp|A1CUF9|ATG2_ASPCL Autophagy-related protein 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg2 PE=3 SV=1 1 2148 0.0E+00
sp|A7E6F5|ATG2_SCLS1 Autophagy-related protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg2 PE=3 SV=1 354 2148 0.0E+00
sp|Q51ZN8|ATG2_MAGO7 Autophagy-related protein 2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG2 PE=3 SV=2 1 2148 0.0E+00
sp|Q871L5|ATG2_NEUCR Autophagy-related protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-2 PE=3 SV=2 1 2148 0.0E+00
sp|A1DP40|ATG2_NEOFI Autophagy-related protein 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg2 PE=3 SV=1 1 1465 1.0E-156
sp|Q6C6M0|ATG2_YARLI Autophagy-related protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG2 PE=3 SV=2 1282 2149 2.0E-128
sp|P0CM30|ATG2_CRYNJ Autophagy-related protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG2 PE=3 SV=1 1601 2148 3.0E-108
sp|P0CM31|ATG2_CRYNB Autophagy-related protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG2 PE=3 SV=1 1601 2148 3.0E-108
sp|A7KAI1|ATG2_PICAN Autophagy-related protein 2 OS=Pichia angusta GN=ATG2 PE=3 SV=1 1604 2023 5.0E-105
sp|Q6BTX0|ATG2_DEBHA Autophagy-related protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG2 PE=3 SV=2 1278 2038 1.0E-102
sp|Q75E74|ATG2_ASHGO Autophagy-related protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG2 PE=3 SV=3 1605 2149 4.0E-91
sp|Q59X11|ATG2_CANAL Autophagy-related protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG2 PE=3 SV=1 1592 2028 6.0E-89
sp|A3LT28|ATG2_PICST Autophagy-related protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG2 PE=3 SV=2 1604 2023 7.0E-89
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 1271 2023 1.0E-88
sp|Q4PFE7|ATG2_USTMA Autophagy-related protein 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG2 PE=3 SV=1 1602 2148 6.0E-87
sp|Q6CQ43|ATG2_KLULA Autophagy-related protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG2 PE=3 SV=1 1603 2148 9.0E-87
sp|P53855|ATG2_YEAST Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG2 PE=1 SV=1 1614 2148 2.0E-84
sp|A6ZRK1|ATG2_YEAS7 Autophagy-related protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG2 PE=3 SV=1 1614 2148 3.0E-84
sp|A7TM79|ATG2_VANPO Autophagy-related protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG2 PE=3 SV=1 1603 2148 2.0E-82
sp|O94649|ATG2_SCHPO Autophagy-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg2 PE=1 SV=4 1279 2148 1.0E-75
sp|A7E6F5|ATG2_SCLS1 Autophagy-related protein 2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg2 PE=3 SV=1 13 328 3.0E-64
sp|Q6FP05|ATG2_CANGA Autophagy-related protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG2 PE=3 SV=1 1618 2148 5.0E-62
sp|A6S7C7|ATG2_BOTFB Autophagy-related protein 2 OS=Botryotinia fuckeliana (strain B05.10) GN=atg2 PE=3 SV=1 4 293 3.0E-54
sp|F8S296|ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana GN=ATG2 PE=2 SV=1 1721 2147 2.0E-41
sp|A2QSC9|ATG2_ASPNC Autophagy-related protein 2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg2 PE=3 SV=1 1 306 2.0E-40
sp|Q0CSI0|ATG2_ASPTN Autophagy-related protein 2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg2 PE=3 SV=1 1 315 3.0E-40
sp|A7KAL3|ATG2_PENRW Autophagy-related protein 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg2 PE=3 SV=1 6 295 1.0E-39
sp|Q5B1T9|ATG2_EMENI Autophagy-related protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg2 PE=3 SV=2 8 304 1.0E-38
sp|Q08D51|ATG2A_XENTR Autophagy-related protein 2 homolog A OS=Xenopus tropicalis GN=atg2a PE=2 SV=1 1711 2148 4.0E-36
sp|Q2TAZ0|ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens GN=ATG2A PE=1 SV=3 1724 2148 2.0E-33
sp|Q4WLK5|ATG2_ASPFU Autophagy-related protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg2 PE=3 SV=1 1 346 2.0E-33
sp|Q6P4T0|ATG2A_MOUSE Autophagy-related protein 2 homolog A OS=Mus musculus GN=Atg2a PE=1 SV=2 1764 2148 5.0E-33
sp|Q80XK6|ATG2B_MOUSE Autophagy-related protein 2 homolog B OS=Mus musculus GN=Atg2b PE=1 SV=3 1860 2149 9.0E-30
sp|Q96BY7|ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens GN=ATG2B PE=1 SV=5 1876 2149 4.0E-28
sp|Q2ULE1|ATG2_ASPOR Autophagy-related protein 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg2 PE=3 SV=1 1 318 4.0E-24
sp|A7KAI1|ATG2_PICAN Autophagy-related protein 2 OS=Pichia angusta GN=ATG2 PE=3 SV=1 2044 2149 3.0E-19
sp|Q9HFR4|ATG2_PICPA Autophagy-related protein 2 OS=Komagataella pastoris GN=ATG2 PE=3 SV=1 2042 2149 7.0E-16
sp|A3LT28|ATG2_PICST Autophagy-related protein 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG2 PE=3 SV=2 2033 2149 9.0E-12
sp|Q6BTX0|ATG2_DEBHA Autophagy-related protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG2 PE=3 SV=2 2051 2149 7.0E-10
sp|Q59X11|ATG2_CANAL Autophagy-related protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG2 PE=3 SV=1 2046 2147 2.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup591
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4485 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5247
Ophiocordyceps australis map64 (Brazil) OphauB2|5248
Ophiocordyceps camponoti-floridani Ophcf2|06839
Ophiocordyceps camponoti-rufipedis Ophun1|3345
Ophiocordyceps kimflemingae Ophio5|5082
Ophiocordyceps subramaniannii Hirsu2|7059
Ophiocordyceps subramaniannii Hirsu2|7060

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4485
MASLFSSFRSSSMPKRLLRYALSRLELLDADALDIDNLDFALGRNTVFEFRDVGIKLKKLEKLLQLPATLKLHKA
GVMLLRVTIPMDFYTSPITVLVQGVDVRLSVTDGDEANQPPQAYRDPSDEVVPNPVHLAQSFLETQPSSERQRLE
QALVAETQDLGASISASDDSSEDEPALGTGHSLSLPEFLADFLQGIVDRMQIKITNVSFELSMNVRTDATTPAPE
PISLQLSFQAIEAQGVTAMDSAGFDSDVKPHIDATQSLPTFTRRGKRLIRLASVRAFLSSEASVMSAFSRQSSAM
SSSSYSSPAMTRSPPDMQESTLSQGSFRHQPMASLQASFRQHLSQDEHLTTAFDPEGDMSLHAQYYDEQVPHDKM
DDCSPPSTPRASLHADYTSWSEQDMFHSTTDVVFSRPGQGSEQEQVRSQASLSRPFPSNIDKDNFGFSATPSPTR
SKMQDLAESHLYTHEEAESMYMSALSSRGPDCSPQQSRPALSTPDEGGMTASISSSTSKSSIPATPPRTRPVMPG
TWDVEYEDSIHDAVYSQDRATSAPKGHIGSENSSPTFNSAVPTLFGQCDPAKGPQPQTDDDNTENDGMKTPKGPA
RVVKKVLELEKISIYVPTHESQYTAHDDTAAESLIPQPQQLSSSSFHLGGPGAFSYHDMSGLSSSTKQSPPQLNA
PPAADFDNILEVILSPLCLQLDATVGLILAKVVEKLLEAFKRDSSSSPPINAPPSLHGRPNPKKTPGIKFSAEEI
SIDFLNRLNGIADSSGRHFWDPSPLVFDQGDVLLNASLQNLSITVSSTDISNKEFAGSSTQTSNIKIETEKFRLG
YPEGDIISFDSSRPMASSVRDTFLACGHDVAIKMVLSAEHVEMAVETLPLIVQLDLQRLDETLGWFGGLSGFLSM
SMSATSSGVSSPNLKPAPLPVRKSRGVHFETPNSPAGSVSKMSRSKVNVRIGGSLIELVGRDRASVAAESKALKI
VIRDEGIGAACSGIRLSGPYLKRSTADAPIAADIGGVRLELSTAPKDRDLEKLLELIIPSKVKFDDGNDGDDGEI
MVDTLLRQRRKGSVLTVNVETVNVRVANIAQVSPALPNLADELTRLSSVATRYLPEDDRPGLLTLATFHTLGLMA
NIGGKFGKLESQVSDIEVAHVTVPSLVAVAVRGLSLRRNDDEDLVGSAAFDKLRTDASWPSDRTGPVIMARMIGD
EMEPTLRLKLQNMRVEYRVPTIMDALGLARDATPQDFEECLAASVVSLSGRAHETLAGQRTWPISQGAKEQEETR
KKRPLTIDLGLYNCLLGLNPLNLSSKMIILFSDARLQTLTAPVKGKTTASMNINKASVLLADRVAEGNTTSTMDT
HPTRAAPQRNPSVSLSPVVAELCAKGFVDICYISSASVVATVKSIPGALDGGKQVEVLVRDDLLVLETCPDSTQT
LIAIMNALKPPTPPSKEDRYRTSIMPMQDLLASISAEAFGKPEGDYDFDQDFAGAQEMMARSVSDAGYDDKLDPS
LRSRSSLDSGDESAAEELFDATRVLPAFSREDTLMQDTAEGVLLTGPKQEQGEDTFEQDSSQELVIHEDYYARDE
AESVHSAKMWNSSKNTYDKAPDSLVNSSPLKLSIRDVHIIWNMFDGYDWARTREVITKAVEDIESKAIERQQRLG
SATQVYEEELDEEEAIGDFLFNSIYIGVDMNRDPRDLTRAINEGLNDDATETDTVITATTNRTARQTHRHSRSKS
KRLRLGRSKRHKITFELRGVDADMVMFPAPQSPNSQETLSSMDVRISSLEIFDHVPTSTWKKFATYDQDRGEREM
GTSMVHLELLTVRPIPQLAASEIVMRVKVLPLRLHVDQDALDFVTRFFEFKDDSSQNTCDSSVSDIPFIQRAEIL
DIPVKLDFKPKRVDYAGLRSGHTTEFMNFVVLEEARMVMRHAIVYGVSGFDRLGKTLNDIWMPDVRRNQLPGVVA
GLAPVRSLVNIGSGFKDLVEIPLREYRKDGRVIRSISKGAFAFARTTGTELVKLGAKIAVGTQYALAGAEEMLSD
KPSREAAEANREEFDDGAEGESEERKQISLYADQPTGVMQGIRGGYRSLTRDVNLARDAIIAVPGEAMESGTASG
AARAVLKRAPTIIFRPAIGMTKAIGQTLLGATNSIDPENKRRISEKYKH*
Coding >OphauG2|4485
ATGGCCTCCTTGTTCAGCTCCTTCAGGAGCTCTAGCATGCCCAAACGCCTGCTGCGCTATGCCCTTTCTCGCTTG
GAGCTGTTGGACGCCGACGCCCTCGACATCGACAATCTCGACTTCGCCTTGGGCCGCAACACCGTCTTCGAATTC
CGAGATGTCGGCATCAAGCTCAAGAAGCTGGAAAAGCTGCTGCAGCTTCCCGCCACCTTGAAACTCCACAAGGCT
GGTGTCATGCTCCTTCGCGTCACTATCCCCATGGATTTCTATACAAGCCCAATTACCGTTCTTGTCCAAGGCGTC
GACGTGAGACTCTCAGTCACCGACGGAGATGAGGCCAATCAACCGCCTCAAGCATATCGAGACCCCTCTGACGAG
GTGGTGCCCAACCCTGTCCATCTGGCTCAGTCCTTTCTCGAGACTCAGCCTTCTTCGGAGCGCCAGAGGTTAGAA
CAAGCCTTGGTTGCAGAGACACAGGACCTTGGCGCATCTATATCCGCCAGTGACGATAGCAGCGAAGACGAGCCT
GCCTTGGGCACTGGACATTCCCTCTCACTCCCCGAGTTCCTGGCCGATTTTCTGCAGGGCATCGTCGACCGCATG
CAAATCAAGATTACCAATGTTAGCTTTGAACTCAGTATGAACGTTCGTACAGACGCGACAACACCGGCTCCCGAG
CCAATCTCCCTTCAACTCTCCTTCCAAGCCATCGAAGCCCAGGGCGTCACAGCCATGGACTCGGCCGGCTTTGAC
TCTGATGTCAAGCCACACATAGATGCCACACAATCATTACCCACCTTCACTAGGCGAGGCAAACGTCTTATTCGT
CTTGCCAGTGTCCGCGCCTTCTTATCTTCCGAGGCTAGTGTAATGTCTGCATTTTCAAGACAATCTTCAGCCATG
TCGTCTTCCTCTTATTCTTCCCCCGCAATGACACGAAGTCCCCCAGACATGCAAGAATCAACTCTCTCTCAAGGC
AGCTTTCGACATCAGCCAATGGCCTCTCTACAGGCTAGCTTTCGCCAGCATCTATCCCAAGACGAACATCTCACT
ACCGCATTCGATCCCGAAGGAGACATGTCCTTGCATGCACAATATTATGATGAACAAGTCCCTCATGATAAGATG
GACGATTGTAGCCCGCCGTCTACCCCACGCGCGTCTTTACATGCAGACTATACTTCCTGGTCAGAACAAGACATG
TTCCACTCAACAACTGATGTGGTGTTTTCACGTCCAGGACAAGGCTCTGAGCAAGAACAAGTGCGCTCACAGGCC
TCTCTCAGTCGACCATTTCCCTCGAATATAGATAAAGACAATTTTGGTTTCTCTGCGACGCCGTCGCCAACGCGC
AGCAAAATGCAAGACCTTGCCGAGTCTCATTTATACACGCACGAAGAAGCAGAAAGCATGTACATGAGTGCTTTA
TCGAGTAGAGGGCCTGATTGTTCCCCCCAACAAAGCCGCCCTGCCCTATCGACGCCAGATGAGGGCGGAATGACT
GCATCAATATCGTCGTCAACTTCCAAGTCGTCAATACCAGCCACACCACCAAGAACACGACCAGTGATGCCTGGG
ACATGGGACGTGGAGTATGAAGACTCGATTCACGACGCAGTTTACTCACAAGATCGAGCAACCAGTGCTCCCAAA
GGTCATATTGGGAGTGAGAACTCTTCTCCGACCTTCAACAGTGCAGTTCCCACCTTATTTGGACAATGTGATCCA
GCCAAGGGCCCTCAGCCTCAGACAGATGACGACAACACGGAAAATGATGGCATGAAAACGCCAAAGGGCCCAGCA
CGAGTCGTGAAAAAGGTTCTCGAGCTCGAAAAAATATCCATTTATGTCCCAACGCATGAAAGCCAATACACGGCC
CATGATGATACAGCGGCCGAGTCCCTGATACCTCAGCCACAGCAGTTGTCCAGTAGTTCATTTCACCTTGGCGGA
CCCGGTGCATTCTCATATCATGATATGTCGGGTTTATCGTCTTCAACCAAACAGTCTCCACCGCAGCTCAATGCA
CCGCCCGCTGCAGATTTTGACAACATTTTGGAGGTGATATTGTCGCCGTTGTGTCTTCAGCTGGACGCTACAGTT
GGACTCATTCTTGCAAAGGTTGTTGAAAAGCTTTTGGAAGCATTCAAACGAGACTCTAGCTCATCCCCTCCCATT
AATGCTCCCCCGTCTTTACATGGCCGGCCAAATCCTAAAAAGACGCCTGGCATCAAGTTTTCTGCCGAGGAAATT
TCGATTGACTTTTTGAATCGTCTAAACGGCATTGCGGATTCGTCTGGCAGGCATTTCTGGGATCCTTCACCACTC
GTATTTGATCAAGGAGATGTGCTCCTCAATGCTTCTTTACAGAATCTATCAATCACGGTGTCCTCAACGGATATT
TCGAACAAAGAATTCGCAGGTAGCTCGACGCAGACTTCCAACATCAAAATCGAAACTGAAAAATTTCGCCTTGGG
TATCCAGAAGGCGACATTATATCCTTTGACAGTAGTCGACCGATGGCGAGCTCTGTGAGAGACACTTTTCTGGCG
TGTGGGCATGACGTGGCAATCAAGATGGTCTTGTCGGCTGAGCATGTGGAAATGGCAGTCGAGACGTTGCCATTG
ATTGTTCAACTGGACTTGCAACGCTTGGACGAGACTTTGGGCTGGTTTGGAGGACTCAGTGGCTTTCTCAGCATG
AGCATGTCGGCAACAAGCAGTGGAGTTTCATCTCCGAATCTCAAACCCGCGCCGCTTCCTGTGCGAAAATCCCGC
GGCGTTCACTTCGAAACTCCAAATAGTCCTGCGGGATCGGTATCGAAAATGTCTCGAAGTAAAGTCAATGTGCGG
ATAGGTGGCTCTTTGATAGAACTCGTGGGCAGAGATCGCGCCAGCGTGGCAGCTGAATCAAAGGCGCTGAAAATC
GTGATACGTGATGAAGGAATCGGAGCCGCCTGCAGTGGTATTCGATTATCAGGACCGTATTTGAAACGCTCAACT
GCCGATGCGCCAATCGCGGCAGATATTGGTGGCGTTCGACTCGAATTGTCGACGGCTCCAAAGGATCGAGACCTG
GAAAAGCTGTTGGAGCTCATTATTCCTTCAAAGGTCAAGTTTGACGATGGAAATGACGGCGACGATGGAGAAATC
ATGGTTGACACTCTGCTCCGACAAAGAAGAAAGGGCTCTGTTCTGACGGTAAATGTCGAAACTGTCAATGTCCGC
GTTGCGAATATAGCTCAGGTCTCGCCCGCTCTGCCAAACCTTGCTGATGAGCTCACGAGACTGTCTTCTGTTGCG
ACTAGATATCTGCCAGAGGATGATCGGCCCGGTCTTCTCACATTAGCCACATTCCACACTTTGGGACTAATGGCT
AATATCGGAGGAAAGTTTGGCAAGCTGGAGAGCCAAGTAAGCGACATTGAGGTTGCTCACGTCACTGTACCATCT
CTCGTAGCTGTTGCTGTCCGTGGCCTATCCCTTCGACGAAACGACGACGAAGACCTTGTTGGTTCTGCAGCTTTT
GATAAGCTCAGAACCGATGCATCTTGGCCTTCTGATAGAACAGGGCCAGTCATCATGGCCAGAATGATTGGGGAT
GAGATGGAGCCAACACTAAGGCTTAAACTCCAAAACATGAGAGTCGAGTATCGGGTGCCGACAATCATGGACGCG
CTCGGGCTTGCTCGCGATGCTACTCCACAGGACTTTGAAGAGTGTCTTGCGGCCTCTGTTGTGAGTTTGAGTGGC
CGTGCTCACGAGACTCTTGCTGGGCAACGAACCTGGCCTATTTCACAGGGAGCGAAAGAACAAGAGGAGACAAGA
AAAAAGCGGCCACTCACGATTGATCTCGGACTGTACAACTGCCTGCTTGGACTAAATCCACTCAACCTGTCGTCC
AAGATGATTATCCTCTTTAGCGACGCCCGTCTGCAGACACTTACAGCTCCTGTCAAGGGTAAAACGACGGCAAGC
ATGAACATCAACAAAGCATCTGTCTTGTTGGCCGATCGTGTTGCTGAAGGCAATACCACATCGACAATGGACACG
CATCCCACGCGTGCAGCTCCTCAGCGGAATCCATCCGTCTCTCTATCTCCAGTTGTCGCAGAACTGTGCGCAAAG
GGATTTGTGGATATTTGCTACATCTCTTCGGCTAGTGTGGTGGCAACGGTCAAGTCGATACCGGGAGCCTTGGAT
GGGGGAAAGCAGGTTGAAGTGTTGGTTCGCGATGATTTACTGGTTCTCGAAACGTGTCCCGACTCGACGCAGACG
CTCATTGCCATTATGAATGCTCTCAAGCCTCCGACGCCACCGAGTAAGGAGGACAGATACCGAACGAGCATTATG
CCCATGCAAGATCTGCTGGCATCTATATCTGCCGAAGCTTTTGGGAAGCCAGAAGGCGATTATGATTTTGACCAA
GATTTTGCCGGGGCACAGGAAATGATGGCAAGAAGTGTCTCGGACGCTGGTTATGATGACAAGCTGGATCCGTCA
TTACGCTCTCGTTCCTCGTTGGATTCCGGAGATGAGTCTGCTGCTGAAGAGCTCTTTGACGCCACCAGAGTACTT
CCTGCTTTTTCACGCGAGGACACTCTAATGCAAGATACTGCTGAGGGGGTCTTGCTGACTGGTCCCAAACAAGAG
CAAGGCGAGGATACGTTTGAACAGGACAGTAGCCAGGAATTAGTCATTCACGAAGACTACTATGCGCGCGACGAG
GCCGAGAGTGTCCATTCAGCCAAAATGTGGAATTCAAGCAAGAATACATATGACAAGGCTCCCGATTCTCTGGTG
AATTCCAGTCCGCTCAAGTTGTCAATAAGGGATGTGCACATTATTTGGAACATGTTTGATGGGTATGACTGGGCC
CGCACTCGTGAAGTGATTACAAAGGCTGTCGAAGACATTGAGAGCAAGGCCATTGAGCGGCAGCAGCGTCTAGGC
AGCGCCACCCAGGTGTACGAAGAGGAACTGGACGAAGAGGAAGCCATTGGGGATTTTTTATTCAACTCGATTTAC
ATCGGAGTTGACATGAACCGCGATCCGCGTGACCTCACCAGGGCCATTAATGAAGGGCTTAACGACGATGCGACT
GAGACGGATACGGTTATTACGGCAACGACAAACCGCACTGCACGCCAGACTCATCGGCATTCTCGGTCCAAGTCC
AAACGCTTGAGGCTCGGCCGCAGCAAACGACATAAAATTACGTTTGAGTTGCGAGGCGTTGACGCCGACATGGTC
ATGTTTCCGGCCCCCCAATCTCCCAATAGTCAGGAAACATTGAGCAGCATGGATGTGAGAATCTCGAGTCTGGAA
ATCTTTGATCACGTACCCACATCAACATGGAAAAAGTTTGCCACATACGACCAAGACCGAGGCGAGCGTGAAATG
GGAACAAGCATGGTTCACCTTGAATTATTGACAGTCCGTCCCATTCCACAGCTTGCAGCATCGGAAATTGTGATG
CGGGTCAAGGTGTTGCCCCTGAGGTTGCACGTGGACCAGGATGCGCTCGACTTTGTGACACGTTTCTTTGAGTTC
AAGGATGACAGCAGCCAAAACACGTGTGACTCTTCAGTCAGTGACATCCCCTTTATACAGCGGGCTGAAATTCTC
GATATACCCGTCAAGTTAGACTTCAAGCCAAAACGTGTTGACTATGCCGGCCTTCGCTCTGGGCACACGACGGAA
TTTATGAACTTTGTCGTGCTGGAGGAGGCGCGCATGGTGATGCGACACGCCATTGTTTATGGCGTGTCGGGGTTT
GACCGCCTGGGCAAAACGCTCAATGACATTTGGATGCCAGATGTCCGCAGGAACCAGCTTCCTGGAGTCGTGGCT
GGTCTAGCGCCGGTTCGGTCGCTTGTCAACATTGGGAGCGGGTTCAAAGACTTGGTTGAAATTCCGCTACGCGAG
TACCGCAAGGACGGGCGGGTTATTCGCAGCATCTCCAAGGGGGCATTTGCCTTTGCGAGAACTACGGGCACGGAA
CTCGTCAAGCTGGGTGCCAAGATTGCTGTGGGCACTCAGTACGCTCTTGCTGGTGCTGAAGAGATGCTGTCGGAC
AAGCCAAGCCGAGAAGCAGCCGAAGCAAACAGGGAAGAGTTTGACGATGGCGCAGAAGGGGAATCCGAGGAAAGG
AAGCAGATTTCGCTCTACGCTGATCAGCCGACGGGCGTCATGCAAGGGATTCGTGGCGGATACCGCTCGTTGACG
CGCGACGTCAACTTGGCCAGAGATGCCATTATTGCCGTGCCAGGTGAAGCCATGGAAAGCGGCACAGCCAGCGGC
GCAGCACGTGCTGTTCTTAAGAGGGCTCCAACCATTATTTTCCGGCCTGCCATTGGAATGACCAAGGCTATTGGG
CAGACTTTGTTGGGTGCGACGAATAGCATTGATCCAGAGAATAAGCGAAGGATCAGCGAGAAATATAAACATTAA
Transcript >OphauG2|4485
ATGGCCTCCTTGTTCAGCTCCTTCAGGAGCTCTAGCATGCCCAAACGCCTGCTGCGCTATGCCCTTTCTCGCTTG
GAGCTGTTGGACGCCGACGCCCTCGACATCGACAATCTCGACTTCGCCTTGGGCCGCAACACCGTCTTCGAATTC
CGAGATGTCGGCATCAAGCTCAAGAAGCTGGAAAAGCTGCTGCAGCTTCCCGCCACCTTGAAACTCCACAAGGCT
GGTGTCATGCTCCTTCGCGTCACTATCCCCATGGATTTCTATACAAGCCCAATTACCGTTCTTGTCCAAGGCGTC
GACGTGAGACTCTCAGTCACCGACGGAGATGAGGCCAATCAACCGCCTCAAGCATATCGAGACCCCTCTGACGAG
GTGGTGCCCAACCCTGTCCATCTGGCTCAGTCCTTTCTCGAGACTCAGCCTTCTTCGGAGCGCCAGAGGTTAGAA
CAAGCCTTGGTTGCAGAGACACAGGACCTTGGCGCATCTATATCCGCCAGTGACGATAGCAGCGAAGACGAGCCT
GCCTTGGGCACTGGACATTCCCTCTCACTCCCCGAGTTCCTGGCCGATTTTCTGCAGGGCATCGTCGACCGCATG
CAAATCAAGATTACCAATGTTAGCTTTGAACTCAGTATGAACGTTCGTACAGACGCGACAACACCGGCTCCCGAG
CCAATCTCCCTTCAACTCTCCTTCCAAGCCATCGAAGCCCAGGGCGTCACAGCCATGGACTCGGCCGGCTTTGAC
TCTGATGTCAAGCCACACATAGATGCCACACAATCATTACCCACCTTCACTAGGCGAGGCAAACGTCTTATTCGT
CTTGCCAGTGTCCGCGCCTTCTTATCTTCCGAGGCTAGTGTAATGTCTGCATTTTCAAGACAATCTTCAGCCATG
TCGTCTTCCTCTTATTCTTCCCCCGCAATGACACGAAGTCCCCCAGACATGCAAGAATCAACTCTCTCTCAAGGC
AGCTTTCGACATCAGCCAATGGCCTCTCTACAGGCTAGCTTTCGCCAGCATCTATCCCAAGACGAACATCTCACT
ACCGCATTCGATCCCGAAGGAGACATGTCCTTGCATGCACAATATTATGATGAACAAGTCCCTCATGATAAGATG
GACGATTGTAGCCCGCCGTCTACCCCACGCGCGTCTTTACATGCAGACTATACTTCCTGGTCAGAACAAGACATG
TTCCACTCAACAACTGATGTGGTGTTTTCACGTCCAGGACAAGGCTCTGAGCAAGAACAAGTGCGCTCACAGGCC
TCTCTCAGTCGACCATTTCCCTCGAATATAGATAAAGACAATTTTGGTTTCTCTGCGACGCCGTCGCCAACGCGC
AGCAAAATGCAAGACCTTGCCGAGTCTCATTTATACACGCACGAAGAAGCAGAAAGCATGTACATGAGTGCTTTA
TCGAGTAGAGGGCCTGATTGTTCCCCCCAACAAAGCCGCCCTGCCCTATCGACGCCAGATGAGGGCGGAATGACT
GCATCAATATCGTCGTCAACTTCCAAGTCGTCAATACCAGCCACACCACCAAGAACACGACCAGTGATGCCTGGG
ACATGGGACGTGGAGTATGAAGACTCGATTCACGACGCAGTTTACTCACAAGATCGAGCAACCAGTGCTCCCAAA
GGTCATATTGGGAGTGAGAACTCTTCTCCGACCTTCAACAGTGCAGTTCCCACCTTATTTGGACAATGTGATCCA
GCCAAGGGCCCTCAGCCTCAGACAGATGACGACAACACGGAAAATGATGGCATGAAAACGCCAAAGGGCCCAGCA
CGAGTCGTGAAAAAGGTTCTCGAGCTCGAAAAAATATCCATTTATGTCCCAACGCATGAAAGCCAATACACGGCC
CATGATGATACAGCGGCCGAGTCCCTGATACCTCAGCCACAGCAGTTGTCCAGTAGTTCATTTCACCTTGGCGGA
CCCGGTGCATTCTCATATCATGATATGTCGGGTTTATCGTCTTCAACCAAACAGTCTCCACCGCAGCTCAATGCA
CCGCCCGCTGCAGATTTTGACAACATTTTGGAGGTGATATTGTCGCCGTTGTGTCTTCAGCTGGACGCTACAGTT
GGACTCATTCTTGCAAAGGTTGTTGAAAAGCTTTTGGAAGCATTCAAACGAGACTCTAGCTCATCCCCTCCCATT
AATGCTCCCCCGTCTTTACATGGCCGGCCAAATCCTAAAAAGACGCCTGGCATCAAGTTTTCTGCCGAGGAAATT
TCGATTGACTTTTTGAATCGTCTAAACGGCATTGCGGATTCGTCTGGCAGGCATTTCTGGGATCCTTCACCACTC
GTATTTGATCAAGGAGATGTGCTCCTCAATGCTTCTTTACAGAATCTATCAATCACGGTGTCCTCAACGGATATT
TCGAACAAAGAATTCGCAGGTAGCTCGACGCAGACTTCCAACATCAAAATCGAAACTGAAAAATTTCGCCTTGGG
TATCCAGAAGGCGACATTATATCCTTTGACAGTAGTCGACCGATGGCGAGCTCTGTGAGAGACACTTTTCTGGCG
TGTGGGCATGACGTGGCAATCAAGATGGTCTTGTCGGCTGAGCATGTGGAAATGGCAGTCGAGACGTTGCCATTG
ATTGTTCAACTGGACTTGCAACGCTTGGACGAGACTTTGGGCTGGTTTGGAGGACTCAGTGGCTTTCTCAGCATG
AGCATGTCGGCAACAAGCAGTGGAGTTTCATCTCCGAATCTCAAACCCGCGCCGCTTCCTGTGCGAAAATCCCGC
GGCGTTCACTTCGAAACTCCAAATAGTCCTGCGGGATCGGTATCGAAAATGTCTCGAAGTAAAGTCAATGTGCGG
ATAGGTGGCTCTTTGATAGAACTCGTGGGCAGAGATCGCGCCAGCGTGGCAGCTGAATCAAAGGCGCTGAAAATC
GTGATACGTGATGAAGGAATCGGAGCCGCCTGCAGTGGTATTCGATTATCAGGACCGTATTTGAAACGCTCAACT
GCCGATGCGCCAATCGCGGCAGATATTGGTGGCGTTCGACTCGAATTGTCGACGGCTCCAAAGGATCGAGACCTG
GAAAAGCTGTTGGAGCTCATTATTCCTTCAAAGGTCAAGTTTGACGATGGAAATGACGGCGACGATGGAGAAATC
ATGGTTGACACTCTGCTCCGACAAAGAAGAAAGGGCTCTGTTCTGACGGTAAATGTCGAAACTGTCAATGTCCGC
GTTGCGAATATAGCTCAGGTCTCGCCCGCTCTGCCAAACCTTGCTGATGAGCTCACGAGACTGTCTTCTGTTGCG
ACTAGATATCTGCCAGAGGATGATCGGCCCGGTCTTCTCACATTAGCCACATTCCACACTTTGGGACTAATGGCT
AATATCGGAGGAAAGTTTGGCAAGCTGGAGAGCCAAGTAAGCGACATTGAGGTTGCTCACGTCACTGTACCATCT
CTCGTAGCTGTTGCTGTCCGTGGCCTATCCCTTCGACGAAACGACGACGAAGACCTTGTTGGTTCTGCAGCTTTT
GATAAGCTCAGAACCGATGCATCTTGGCCTTCTGATAGAACAGGGCCAGTCATCATGGCCAGAATGATTGGGGAT
GAGATGGAGCCAACACTAAGGCTTAAACTCCAAAACATGAGAGTCGAGTATCGGGTGCCGACAATCATGGACGCG
CTCGGGCTTGCTCGCGATGCTACTCCACAGGACTTTGAAGAGTGTCTTGCGGCCTCTGTTGTGAGTTTGAGTGGC
CGTGCTCACGAGACTCTTGCTGGGCAACGAACCTGGCCTATTTCACAGGGAGCGAAAGAACAAGAGGAGACAAGA
AAAAAGCGGCCACTCACGATTGATCTCGGACTGTACAACTGCCTGCTTGGACTAAATCCACTCAACCTGTCGTCC
AAGATGATTATCCTCTTTAGCGACGCCCGTCTGCAGACACTTACAGCTCCTGTCAAGGGTAAAACGACGGCAAGC
ATGAACATCAACAAAGCATCTGTCTTGTTGGCCGATCGTGTTGCTGAAGGCAATACCACATCGACAATGGACACG
CATCCCACGCGTGCAGCTCCTCAGCGGAATCCATCCGTCTCTCTATCTCCAGTTGTCGCAGAACTGTGCGCAAAG
GGATTTGTGGATATTTGCTACATCTCTTCGGCTAGTGTGGTGGCAACGGTCAAGTCGATACCGGGAGCCTTGGAT
GGGGGAAAGCAGGTTGAAGTGTTGGTTCGCGATGATTTACTGGTTCTCGAAACGTGTCCCGACTCGACGCAGACG
CTCATTGCCATTATGAATGCTCTCAAGCCTCCGACGCCACCGAGTAAGGAGGACAGATACCGAACGAGCATTATG
CCCATGCAAGATCTGCTGGCATCTATATCTGCCGAAGCTTTTGGGAAGCCAGAAGGCGATTATGATTTTGACCAA
GATTTTGCCGGGGCACAGGAAATGATGGCAAGAAGTGTCTCGGACGCTGGTTATGATGACAAGCTGGATCCGTCA
TTACGCTCTCGTTCCTCGTTGGATTCCGGAGATGAGTCTGCTGCTGAAGAGCTCTTTGACGCCACCAGAGTACTT
CCTGCTTTTTCACGCGAGGACACTCTAATGCAAGATACTGCTGAGGGGGTCTTGCTGACTGGTCCCAAACAAGAG
CAAGGCGAGGATACGTTTGAACAGGACAGTAGCCAGGAATTAGTCATTCACGAAGACTACTATGCGCGCGACGAG
GCCGAGAGTGTCCATTCAGCCAAAATGTGGAATTCAAGCAAGAATACATATGACAAGGCTCCCGATTCTCTGGTG
AATTCCAGTCCGCTCAAGTTGTCAATAAGGGATGTGCACATTATTTGGAACATGTTTGATGGGTATGACTGGGCC
CGCACTCGTGAAGTGATTACAAAGGCTGTCGAAGACATTGAGAGCAAGGCCATTGAGCGGCAGCAGCGTCTAGGC
AGCGCCACCCAGGTGTACGAAGAGGAACTGGACGAAGAGGAAGCCATTGGGGATTTTTTATTCAACTCGATTTAC
ATCGGAGTTGACATGAACCGCGATCCGCGTGACCTCACCAGGGCCATTAATGAAGGGCTTAACGACGATGCGACT
GAGACGGATACGGTTATTACGGCAACGACAAACCGCACTGCACGCCAGACTCATCGGCATTCTCGGTCCAAGTCC
AAACGCTTGAGGCTCGGCCGCAGCAAACGACATAAAATTACGTTTGAGTTGCGAGGCGTTGACGCCGACATGGTC
ATGTTTCCGGCCCCCCAATCTCCCAATAGTCAGGAAACATTGAGCAGCATGGATGTGAGAATCTCGAGTCTGGAA
ATCTTTGATCACGTACCCACATCAACATGGAAAAAGTTTGCCACATACGACCAAGACCGAGGCGAGCGTGAAATG
GGAACAAGCATGGTTCACCTTGAATTATTGACAGTCCGTCCCATTCCACAGCTTGCAGCATCGGAAATTGTGATG
CGGGTCAAGGTGTTGCCCCTGAGGTTGCACGTGGACCAGGATGCGCTCGACTTTGTGACACGTTTCTTTGAGTTC
AAGGATGACAGCAGCCAAAACACGTGTGACTCTTCAGTCAGTGACATCCCCTTTATACAGCGGGCTGAAATTCTC
GATATACCCGTCAAGTTAGACTTCAAGCCAAAACGTGTTGACTATGCCGGCCTTCGCTCTGGGCACACGACGGAA
TTTATGAACTTTGTCGTGCTGGAGGAGGCGCGCATGGTGATGCGACACGCCATTGTTTATGGCGTGTCGGGGTTT
GACCGCCTGGGCAAAACGCTCAATGACATTTGGATGCCAGATGTCCGCAGGAACCAGCTTCCTGGAGTCGTGGCT
GGTCTAGCGCCGGTTCGGTCGCTTGTCAACATTGGGAGCGGGTTCAAAGACTTGGTTGAAATTCCGCTACGCGAG
TACCGCAAGGACGGGCGGGTTATTCGCAGCATCTCCAAGGGGGCATTTGCCTTTGCGAGAACTACGGGCACGGAA
CTCGTCAAGCTGGGTGCCAAGATTGCTGTGGGCACTCAGTACGCTCTTGCTGGTGCTGAAGAGATGCTGTCGGAC
AAGCCAAGCCGAGAAGCAGCCGAAGCAAACAGGGAAGAGTTTGACGATGGCGCAGAAGGGGAATCCGAGGAAAGG
AAGCAGATTTCGCTCTACGCTGATCAGCCGACGGGCGTCATGCAAGGGATTCGTGGCGGATACCGCTCGTTGACG
CGCGACGTCAACTTGGCCAGAGATGCCATTATTGCCGTGCCAGGTGAAGCCATGGAAAGCGGCACAGCCAGCGGC
GCAGCACGTGCTGTTCTTAAGAGGGCTCCAACCATTATTTTCCGGCCTGCCATTGGAATGACCAAGGCTATTGGG
CAGACTTTGTTGGGTGCGACGAATAGCATTGATCCAGAGAATAAGCGAAGGATCAGCGAGAAATATAAACATTAA
Gene >OphauG2|4485
ATGGCCTCCTTGTTCAGCTCCTTCAGGAGCTCTAGCATGCCCAAACGCCTGCTGCGCTATGCCCTTTCTCGCTTG
GAGCTGTTGGACGCCGACGCCCTCGACATCGACAATCTCGACTTCGCCTTGGGCCGCAACACCGTCTTCGAATTC
CGAGATGTCGGCATCAAGCTCAAGGTGCTCCCTGTCCCACCCGACTCGCCTTGGTACCCAGCTGGCTGACTGTTG
GTCCAGAAGCTGGAAAAGCTGCTGCAGCTTCCCGCCACCTTGAAACTCCACAAGGCTGGTGTCATGCTCCTTCGC
GTCACTATCCCCATGGATTTCTATACAAGCCCAATTACCGTTCTTGTCCAAGGCGTCGACGTGAGACTCTCAGTC
ACCGACGGAGATGAGGCCAATCAACCGCCTCAAGCATATCGAGACCCCTCTGACGAGGTGGTGCCCAACCCTGTC
CATCTGGCTCAGTCCTTTCTCGAGACTCAGCCTTCTTCGGAGCGCCAGAGGTTAGAACAAGCCTTGGTTGCAGAG
ACACAGGACCTTGGCGCATCTATATCCGCCAGTGACGATAGCAGCGAAGACGAGCCTGCCTTGGGCACTGGACAT
TCCCTCTCACTCCCCGAGTTCCTGGCCGATTTTCTGCAGGGCATCGTCGACCGCATGCAAATCAAGATTACCAAT
GTTAGCTTTGAACTCAGTATGAACGTTCGTACAGACGCGACAACACCGGCTCCCGAGCCAATCTCCCTTCAACTC
TCCTTCCAAGCCATCGAAGCCCAGGGCGTCACAGCCATGGACTCGGCCGGCTTTGACTCTGATGTCAAGCCACAC
ATAGATGCCACACAATCATTACCCACCTTCACTAGGCGAGGCAAACGTCTTATTCGTCTTGCCAGTGTCCGCGCC
TTCTTATCTTCCGAGGCTAGTGTAATGTCTGCATTTTCAAGACAATCTTCAGCCATGTCGTCTTCCTCTTATTCT
TCCCCCGCAATGACACGAAGTCCCCCAGACATGCAAGAATCAACTCTCTCTCAAGGCAGCTTTCGACATCAGCCA
ATGGCCTCTCTACAGGCTAGCTTTCGCCAGCATCTATCCCAAGACGAACATCTCACTACCGCATTCGATCCCGAA
GGAGACATGTCCTTGCATGCACAATATTATGATGAACAAGTCCCTCATGATAAGATGGACGATTGTAGCCCGCCG
TCTACCCCACGCGCGTCTTTACATGCAGACTATACTTCCTGGTCAGAACAAGACATGTTCCACTCAACAACTGAT
GTGGTGTTTTCACGTCCAGGACAAGGCTCTGAGCAAGAACAAGTGCGCTCACAGGCCTCTCTCAGTCGACCATTT
CCCTCGAATATAGATAAAGACAATTTTGGTTTCTCTGCGACGCCGTCGCCAACGCGCAGCAAAATGCAAGACCTT
GCCGAGTCTCATTTATACACGCACGAAGAAGCAGAAAGCATGTACATGAGTGCTTTATCGAGTAGAGGGCCTGAT
TGTTCCCCCCAACAAAGCCGCCCTGCCCTATCGACGCCAGATGAGGGCGGAATGACTGCATCAATATCGTCGTCA
ACTTCCAAGTCGTCAATACCAGCCACACCACCAAGAACACGACCAGTGATGCCTGGGACATGGGACGTGGAGTAT
GAAGACTCGATTCACGACGCAGTTTACTCACAAGATCGAGCAACCAGTGCTCCCAAAGGTCATATTGGGAGTGAG
AACTCTTCTCCGACCTTCAACAGTGCAGTTCCCACCTTATTTGGACAATGTGATCCAGCCAAGGGCCCTCAGCCT
CAGACAGATGACGACAACACGGAAAATGATGGCATGAAAACGCCAAAGGGCCCAGCACGAGTCGTGAAAAAGGTT
CTCGAGCTCGAAAAAATATCCATTTATGTCCCAACGCATGAAAGCCAATACACGGCCCATGATGATACAGCGGCC
GAGTCCCTGATACCTCAGCCACAGCAGTTGTCCAGTAGTTCATTTCACCTTGGCGGACCCGGTGCATTCTCATAT
CATGATATGTCGGGTTTATCGTCTTCAACCAAACAGTCTCCACCGCAGCTCAATGCACCGCCCGCTGCAGATTTT
GACAACATTTTGGAGGTGATATTGTCGCCGTTGTGTCTTCAGCTGGACGCTACAGTTGGACTCATTCTTGCAAAG
GTTGTTGAAAAGCTTTTGGAAGCATTCAAACGAGACTCTAGCTCATCCCCTCCCATTAATGCTCCCCCGTCTTTA
CATGGCCGGCCAAATCCTAAAAAGACGCCTGGCATCAAGTTTTCTGCCGAGGAAATTTCGATTGACTTTTTGAAT
CGTCTAAACGGCATTGCGGATTCGTCTGGCAGGCATTTCTGGGATCCTTCACCACTCGTATTTGATCAAGGAGAT
GTGCTCCTCAATGCTTCTTTACAGAATCTATCAATCACGGTGTCCTCAACGGATATTTCGAACAAAGAATTCGCA
GGTAGCTCGACGCAGACTTCCAACATCAAAATCGAAACTGAAAAATTTCGCCTTGGGTATCCAGAAGGCGACATT
ATATCCTTTGACAGTAGTCGACCGATGGCGAGCTCTGTGAGAGACACTTTTCTGGCGTGTGGGCATGACGTGGCA
ATCAAGATGGTCTTGTCGGCTGAGCATGTGGAAATGGCAGTCGAGACGTTGCCATTGATTGTTCAACTGGACTTG
CAACGCTTGGACGAGACTTTGGGCTGGTTTGGAGGACTCAGTGGCTTTCTCAGCATGAGCATGTCGGCAACAAGC
AGTGGAGTTTCATCTCCGAATCTCAAACCCGCGCCGCTTCCTGTGCGAAAATCCCGCGGCGTTCACTTCGAAACT
CCAAATAGTCCTGCGGGATCGGTATCGAAAATGTCTCGAAGTAAAGTCAATGTGCGGATAGGTGGCTCTTTGATA
GAACTCGTGGGCAGAGATCGCGCCAGCGTGGCAGCTGAATCAAAGGCGCTGAAAATCGTGATACGTGATGAAGGA
ATCGGAGCCGCCTGCAGTGGTATTCGATTATCAGGACCGTATTTGAAACGCTCAACTGCCGATGCGCCAATCGCG
GCAGATATTGGTGGCGTTCGACTCGAATTGTCGACGGCTCCAAAGGATCGAGACCTGGAAAAGCTGTTGGAGCTC
ATTATTCCTTCAAAGGTCAAGTTTGACGATGGAAATGACGGCGACGATGGAGAAATCATGGTTGACACTCTGCTC
CGACAAAGAAGAAAGGGCTCTGTTCTGACGGTAAATGTCGAAACTGTCAATGTCCGCGTTGCGAATATAGCTCAG
GTCTCGCCCGCTCTGCCAAACCTTGCTGATGAGCTCACGAGACTGTCTTCTGTTGCGACTAGATATCTGCCAGAG
GATGATCGGCCCGGTCTTCTCACATTAGCCACATTCCACACTTTGGGACTAATGGCTAATATCGGAGGAAAGTTT
GGCAAGCTGGAGAGCCAAGTAAGCGACATTGAGGTTGCTCACGTCACTGTACCATCTCTCGTAGCTGTTGCTGTC
CGTGGCCTATCCCTTCGACGAAACGACGACGAAGACCTTGTTGGTTCTGCAGCTTTTGATAAGCTCAGAACCGAT
GCATCTTGGCCTTCTGATAGAACAGGGCCAGTCATCATGGCCAGAATGATTGGGGATGAGATGGAGCCAACACTA
AGGCTTAAACTCCAAAACATGAGAGTCGAGTATCGGGTGCCGACAATCATGGACGCGCTCGGGCTTGCTCGCGAT
GCTACTCCACAGGACTTTGAAGAGTGTCTTGCGGCCTCTGTTGTGAGTTTGAGTGGCCGTGCTCACGAGACTCTT
GCTGGGCAACGAACCTGGCCTATTTCACAGGGAGCGAAAGAACAAGAGGAGACAAGAAAAAAGCGGCCACTCACG
ATTGATCTCGGACTGTACAACTGCCTGCTTGGACTAAATCCACTCAACCTGTCGTCCAAGATGATTATCCTCTTT
AGCGACGCCCGTCTGCAGACACTTACAGCTCCTGTCAAGGGTAAAACGACGGCAAGCATGAACATCAACAAAGCA
TCTGTCTTGTTGGCCGATCGTGTTGCTGAAGGCAATACCACATCGACAATGGACACGCATCCCACGCGTGCAGCT
CCTCAGCGGAATCCATCCGTCTCTCTATCTCCAGTTGTCGCAGAACTGTGCGCAAAGGGATTTGTGGATATTTGC
TACATCTCTTCGGCTAGTGTGGTGGCAACGGTCAAGTCGATACCGGGAGCCTTGGATGGGGGAAAGCAGGTTGAA
GTGTTGGTTCGCGATGATTTACTGGTTCTCGAAACGTGTCCCGACTCGACGCAGACGCTCATTGCCATTATGAAT
GCTCTCAAGCCTCCGACGCCACCGAGTAAGGAGGACAGATACCGAACGAGCATTATGCCCATGCAAGATCTGCTG
GCATCTATATCTGCCGAAGCTTTTGGGAAGCCAGAAGGCGATTATGATTTTGACCAAGATTTTGCCGGGGCACAG
GAAATGATGGCAAGAAGTGTCTCGGACGCTGGTTATGATGACAAGCTGGATCCGTCATTACGCTCTCGTTCCTCG
TTGGATTCCGGAGATGAGTCTGCTGCTGAAGAGCTCTTTGACGCCACCAGAGTACTTCCTGCTTTTTCACGCGAG
GACACTCTAATGCAAGATACTGCTGAGGGGGTCTTGCTGACTGGTCCCAAACAAGAGCAAGGCGAGGATACGTTT
GAACAGGACAGTAGCCAGGAATTAGTCATTCACGAAGACTACTATGCGCGCGACGAGGCCGAGAGTGTCCATTCA
GCCAAAATGTGGAATTCAAGCAAGAATACATATGACAAGGCTCCCGATTCTCTGGTGAATTCCAGTCCGCTCAAG
TTGTCAATAAGGGATGTGCACATTATTTGGAACATGTTTGATGGGTATGACTGGGCCCGCACTCGTGAAGTGATT
ACAAAGGCTGTCGAAGACATTGAGAGCAAGGCCATTGAGCGGCAGCAGCGTCTAGGCAGCGCCACCCAGGTGTAC
GAAGAGGAACTGGACGAAGAGGAAGCCATTGGGGATTTTTTATTCAACTCGATTTACATCGGAGTTGACATGAAC
CGCGATCCGCGTGACCTCACCAGGGCCATTAATGAAGGGCTTAACGACGATGCGACTGAGACGGATACGGTTATT
ACGGCAACGACAAACCGCACTGCACGCCAGACTCATCGGCATTCTCGGTCCAAGTCCAAACGCTTGAGGCTCGGC
CGCAGCAAACGACATAAAATTACGTTTGAGTTGCGAGGCGTTGACGCCGACATGGTCATGTTTCCGGCCCCCCAA
TCTCCCAATAGTCAGGAAACATTGAGCAGCATGGATGTGAGAATCTCGAGTCTGGAAATCTTTGATCACGTACCC
ACATCAACATGGAAAAAGTTTGCCACATACGACCAAGACCGAGGCGAGCGTGAAATGGGAACAAGCATGGTTCAC
CTTGAATTATTGACAGTCCGTCCCATTCCACAGCTTGCAGCATCGGAAATTGTGATGCGGGTCAAGGTGTTGCCC
CTGAGGTTGCACGTGGACCAGGATGCGCTCGACTTTGTGACACGTTTCTTTGAGTTCAAGGATGACAGCAGCCAA
AACACGTGTGACTCTTCAGTCAGTGACATCCCCTTTATACAGCGGGCTGAAATTCTCGATATACCCGTCAAGTTA
GACTTCAAGCCAAAACGTGTTGACTATGCCGGCCTTCGCTCTGGGCACACGACGGAATTTATGAACTTTGTCGTG
CTGGAGGAGGCGCGCATGGTGATGCGACACGCCATTGTTTATGGCGTGTCGGGGTTTGACCGCCTGGGCAAAACG
CTCAATGACATTTGGATGCCAGATGTCCGCAGGAACCAGCTTCCTGGAGTCGTGGCTGGTCTAGCGCCGGTTCGG
TCGCTTGTCAACATTGGGAGCGGGTTCAAAGACTTGGTTGAAATTCCGCTACGCGAGTACCGCAAGGACGGGCGG
GTTATTCGCAGCATCTCCAAGGGGGCATTTGCCTTTGCGAGAACTACGGGCACGGAACTCGTCAAGCTGGGTGCC
AAGATTGCTGTGGGCACTCAGTACGCTCTTGCTGGTGCTGAAGAGATGCTGTCGGACAAGCCAAGCCGAGAAGCA
GCCGAAGCAAACAGGGAAGAGTTTGACGATGGCGCAGAAGGGGAATCCGAGGAAAGGAAGCAGATTTCGCTCTAC
GCTGATCAGCCGACGGGCGTCATGCAAGGGATTCGTGGCGGATACCGCTCGTTGACGCGCGACGTCAACTTGGCC
AGAGATGCCATTATTGCCGTGCCAGGTGAAGCCATGGAAAGCGGCACAGCCAGCGGCGCAGCACGTGCTGTTCTT
AAGAGGGCTCCAACCATTATTTTCCGGCCTGCCATTGGAATGACCAAGGCTATTGGGCAGACTTTGTTGGGTGCG
ACGAATAGCATTGATCCAGAGAATAAGCGAAGGATCAGCGAGGTGAGTCTAGCCTTCGGTATTGTTGGCTGCGGC
TCGAAGCGTTTCAGCTAACCAAGACGATAGAAATATAAACATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail