Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4472
Gene name
LocationContig_375:15236..15805
Strand+
Gene length (bp)569
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8 4.1E-43 30 169

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20436|RPAB3_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB8 PE=1 SV=1 27 169 6.0E-24
sp|Q92399|RPAB3_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb8 PE=1 SV=2 24 169 8.0E-22
sp|Q923G2|RPAB3_MOUSE DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Mus musculus GN=Polr2h PE=1 SV=3 28 169 1.0E-21
sp|P52434|RPAB3_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens GN=POLR2H PE=1 SV=4 28 169 1.0E-21
sp|O81097|RPB8A_ARATH DNA-directed RNA polymerases II and V subunit 8A OS=Arabidopsis thaliana GN=NRPB8A PE=1 SV=1 23 169 5.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20436|RPAB3_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB8 PE=1 SV=1 27 169 6.0E-24
sp|Q92399|RPAB3_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb8 PE=1 SV=2 24 169 8.0E-22
sp|Q923G2|RPAB3_MOUSE DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Mus musculus GN=Polr2h PE=1 SV=3 28 169 1.0E-21
sp|P52434|RPAB3_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens GN=POLR2H PE=1 SV=4 28 169 1.0E-21
sp|O81097|RPB8A_ARATH DNA-directed RNA polymerases II and V subunit 8A OS=Arabidopsis thaliana GN=NRPB8A PE=1 SV=1 23 169 5.0E-19
sp|Q54YW8|RPAB3_DICDI DNA-directed RNA polymerases I, II, and III subunit rpabc3 OS=Dictyostelium discoideum GN=polr2h PE=3 SV=1 26 169 8.0E-19
sp|A8XT81|RPAB3_CAEBR Probable DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Caenorhabditis briggsae GN=rpb-8 PE=3 SV=1 27 169 1.0E-18
sp|Q19826|RPAB3_CAEEL Probable DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Caenorhabditis elegans GN=rpb-8 PE=1 SV=1 28 169 3.0E-18
sp|Q9M1A8|RPB8B_ARATH DNA-directed RNA polymerases II, IV and V subunit 8B OS=Arabidopsis thaliana GN=NRPB8B PE=1 SV=1 23 169 3.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0043170 macromolecule metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4472
MSTASSGTAGAGTSATGTGNSTGGDATLFEESFTITEYDQAKYDRVARISCTSSDARTFMTLDINTELLFCDKTD
SLHVVLTTTLSPDGTKDDDKGWRDVGKAGGDGPATIADLFDYVCYGKVYKFDETYDGNTINAYVSFGGLLMSLQG
PVKKLIPLRVDNVYLLIKK*
Coding >OphauG2|4472
ATGTCGACTGCCAGCAGCGGCACCGCTGGTGCAGGTACAAGCGCCACTGGTACTGGCAACTCTACTGGCGGCGAC
GCGACCCTCTTTGAGGAAAGCTTTACGATAACGGAGTATGACCAGGCAAAATACGACCGCGTGGCTCGAATCTCG
TGTACCTCGAGTGACGCACGCACCTTTATGACTCTTGACATCAACACCGAGCTCCTCTTTTGCGACAAGACAGAT
TCGCTTCATGTCGTCCTTACCACAACACTTTCACCCGACGGCACAAAAGACGACGATAAAGGCTGGCGGGATGTG
GGCAAGGCGGGGGGTGACGGGCCTGCCACCATAGCCGACCTCTTTGATTATGTCTGCTACGGCAAGGTTTACAAG
TTTGATGAGACATATGATGGCAACACAATCAACGCATATGTTTCATTTGGTGGCCTACTTATGTCGCTTCAGGGC
CCGGTGAAGAAGCTTATACCGCTGCGCGTCGACAACGTCTATCTATTGATCAAGAAATAG
Transcript >OphauG2|4472
ATGTCGACTGCCAGCAGCGGCACCGCTGGTGCAGGTACAAGCGCCACTGGTACTGGCAACTCTACTGGCGGCGAC
GCGACCCTCTTTGAGGAAAGCTTTACGATAACGGAGTATGACCAGGCAAAATACGACCGCGTGGCTCGAATCTCG
TGTACCTCGAGTGACGCACGCACCTTTATGACTCTTGACATCAACACCGAGCTCCTCTTTTGCGACAAGACAGAT
TCGCTTCATGTCGTCCTTACCACAACACTTTCACCCGACGGCACAAAAGACGACGATAAAGGCTGGCGGGATGTG
GGCAAGGCGGGGGGTGACGGGCCTGCCACCATAGCCGACCTCTTTGATTATGTCTGCTACGGCAAGGTTTACAAG
TTTGATGAGACATATGATGGCAACACAATCAACGCATATGTTTCATTTGGTGGCCTACTTATGTCGCTTCAGGGC
CCGGTGAAGAAGCTTATACCGCTGCGCGTCGACAACGTCTATCTATTGATCAAGAAATAG
Gene >OphauG2|4472
ATGTCGACTGCCAGCAGCGGCACCGCTGGTGCAGGTACAAGCGCCACTGGTACTGGCAACTCTACTGGCGGCGAC
GCGACCCTCTTTGAGGAAAGCTTTACGATAACGGAGTATGACCAGGCAAAATACGACCGCGTGGCTCGAATCTCG
TGTACCTCGAGTGACGCACGCACCTTTATGACTCTTGACATCAACACCGAGCTCCTCTTTTGCGACAAGACAGAT
TCGCTTCATGTCGTCCTTACCACAACACTTTCACCCGACGGCACAAAAGACGACGATAAAGGCTGGCGGGATGTG
GGCAAGGCGGGGGGTGACGGGCCTGCCACCATAGCCGACCTCTTTGATTATGTCTGCTACGGCAAGGTTTACAAG
TTTGATGAGACATATGATGGCAACACAATGTGGGTTATACCAATGCTAAACCGCATCAACTCTCCCGATTGACTT
ACGCCTTTGACAGCAACGCATATGTTTCATTTGGTGGCCTACTTATGTCGCTTCAGGGCCCGGTGAAGAAGCTTA
TACCGCTGCGCGTCGACAACGTCTATCTATTGATCAAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail