Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|446
Gene name
LocationContig_11:51401..54938
Strand-
Gene length (bp)3537
Transcript length (bp)3474
Coding sequence length (bp)3474
Protein length (aa) 1158

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00850 Hist_deacetyl Histone deacetylase domain 4.4E-58 242 577

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q02959|HOS3_YEAST Histone deacetylase HOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS3 PE=1 SV=1 160 578 4.0E-93
sp|Q54VQ7|HDA22_DICDI Type-2 histone deacetylase 2 OS=Dictyostelium discoideum GN=hdaC PE=2 SV=1 304 581 3.0E-23
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 305 563 3.0E-16
sp|Q54X15|HDA21_DICDI Type-2 histone deacetylase 1 OS=Dictyostelium discoideum GN=hdaD PE=2 SV=1 298 394 3.0E-16
sp|Q6P3E7|HDA10_MOUSE Histone deacetylase 10 OS=Mus musculus GN=Hdac10 PE=2 SV=2 318 584 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q02959|HOS3_YEAST Histone deacetylase HOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS3 PE=1 SV=1 160 578 4.0E-93
sp|Q54VQ7|HDA22_DICDI Type-2 histone deacetylase 2 OS=Dictyostelium discoideum GN=hdaC PE=2 SV=1 304 581 3.0E-23
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 305 563 3.0E-16
sp|Q54X15|HDA21_DICDI Type-2 histone deacetylase 1 OS=Dictyostelium discoideum GN=hdaD PE=2 SV=1 298 394 3.0E-16
sp|Q6P3E7|HDA10_MOUSE Histone deacetylase 10 OS=Mus musculus GN=Hdac10 PE=2 SV=2 318 584 2.0E-14
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 305 763 2.0E-14
sp|Q969S8|HDA10_HUMAN Histone deacetylase 10 OS=Homo sapiens GN=HDAC10 PE=1 SV=1 318 584 4.0E-14
sp|P83038|HDAC4_CHICK Histone deacetylase 4 OS=Gallus gallus GN=HDAC4 PE=2 SV=1 318 582 1.0E-13
sp|Q99P99|HDAC4_RAT Histone deacetylase 4 OS=Rattus norvegicus GN=Hdac4 PE=1 SV=2 318 582 3.0E-13
sp|P56524|HDAC4_HUMAN Histone deacetylase 4 OS=Homo sapiens GN=HDAC4 PE=1 SV=3 318 582 4.0E-13
sp|P72702|Y245_SYNY3 Uncharacterized protein slr0245 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0245 PE=3 SV=1 250 579 6.0E-13
sp|Q6NZM9|HDAC4_MOUSE Histone deacetylase 4 OS=Mus musculus GN=Hdac4 PE=1 SV=1 318 582 8.0E-13
sp|Q8C2B3|HDAC7_MOUSE Histone deacetylase 7 OS=Mus musculus GN=Hdac7 PE=1 SV=2 311 582 1.0E-12
sp|Q9UKV0|HDAC9_HUMAN Histone deacetylase 9 OS=Homo sapiens GN=HDAC9 PE=1 SV=2 318 582 2.0E-12
sp|Q9Z2V5|HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus GN=Hdac6 PE=1 SV=3 262 584 4.0E-12
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 263 584 4.0E-12
sp|Q8WUI4|HDAC7_HUMAN Histone deacetylase 7 OS=Homo sapiens GN=HDAC7 PE=1 SV=2 313 582 5.0E-12
sp|Q9UBN7|HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens GN=HDAC6 PE=1 SV=2 305 563 4.0E-11
sp|Q57955|Y535_METJA Uncharacterized protein MJ0535 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0535 PE=3 SV=1 301 399 1.0E-10
sp|O30107|Y130_ARCFU Uncharacterized protein AF_0130 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0130 PE=3 SV=1 318 563 3.0E-10
sp|Q5A960|HDA1_CANAL Histone deacetylase HDA1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HDA1 PE=1 SV=1 303 581 4.0E-10
sp|Q70I53|HDAH_ALCSD Histone deacetylase-like amidohydrolase OS=Alcaligenes sp. (strain DSM 11172) GN=hdaH PE=1 SV=3 320 578 4.0E-10
sp|Q941D6|HDA14_ARATH Histone deacetylase 14 OS=Arabidopsis thaliana GN=HDA14 PE=2 SV=1 318 393 5.0E-10
sp|Q8RX28|HDA5_ARATH Histone deacetylase 5 OS=Arabidopsis thaliana GN=HDA5 PE=1 SV=1 305 582 7.0E-10
sp|P56523|CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clr3 PE=1 SV=1 305 580 8.0E-10
sp|Q9Z2V6|HDAC5_MOUSE Histone deacetylase 5 OS=Mus musculus GN=Hdac5 PE=1 SV=2 314 579 1.0E-09
sp|Q9UQL6|HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens GN=HDAC5 PE=1 SV=2 314 579 2.0E-09
sp|Q80ZH1|HDAC5_CRIGR Histone deacetylase 5 OS=Cricetulus griseus GN=HDAC5 PE=2 SV=1 314 579 3.0E-09
sp|Q5R902|HDAC5_PONAB Histone deacetylase 5 OS=Pongo abelii GN=HDAC5 PE=2 SV=1 314 579 3.0E-09
sp|Q569C4|HDA10_RAT Histone deacetylase 10 OS=Rattus norvegicus GN=Hdac10 PE=2 SV=1 326 394 4.0E-09
sp|O27262|Y1194_METTH Uncharacterized protein MTH_1194 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_1194 PE=3 SV=1 304 397 6.0E-09
sp|Q8LRK8|HDA18_ARATH Histone deacetylase 18 OS=Arabidopsis thaliana GN=HDA18 PE=2 SV=1 305 582 2.0E-08
sp|Q48935|APHA_MYCRA Acetylpolyamine aminohydrolase OS=Mycoplana ramosa GN=aphA PE=1 SV=1 306 397 3.0E-08
sp|Q8GXJ1|HDA15_ARATH Histone deacetylase 15 OS=Arabidopsis thaliana GN=HDA15 PE=2 SV=2 329 594 3.0E-08
sp|Q613L4|HDA4_CAEBR Histone deacetylase 4 OS=Caenorhabditis briggsae GN=hda-4 PE=3 SV=1 318 392 7.0E-07
sp|Q20296|HDA6_CAEEL Histone deacetylase 6 OS=Caenorhabditis elegans GN=hda-6 PE=3 SV=2 305 396 7.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2291
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|446 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2572
Ophiocordyceps camponoti-floridani Ophcf2|06376
Ophiocordyceps camponoti-rufipedis Ophun1|3732
Ophiocordyceps kimflemingae Ophio5|4608
Ophiocordyceps subramaniannii Hirsu2|3033

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|446
MQSPATPVPAQPSPPRHSQTAANATDEGDCLADSLLQLSLSSKMMSTPPKRPSSRRSSGLSADPRRPSHSPFQAQ
EARTTSPPGVRYRASASSLRSLGIAAPPTRGSMSRRSSSAQVMSPTAIRTVSASHDEEKPFVTANSLARNHLQAE
LASLHGILSPLPTETIVVLNDAVYGHRYARPRTSRSALSTIVERPERIKATVLGISTAYVRLGGRHEHGSNPIQP
DASTHSLTGIPFRIHKTTRRLPLASPAVTNVHGSKWMEELKMMCDSAEAKLAMGGKELQRPDMYRGPDAEPPQKL
HQGDLYLCSESLDAMEGALGAVCEAVDAVFTSPHRRAFVGARPPGHHCSASHPSGFCWVNNVHIGIMHAALAHGL
THAVIIDFDLHHGDGSQDITWKHNSRARLAAKNASAWKKTSIGYFSLHDINSYPCEYGDDEKVQSASLCIDNAHA
QTIWNIHLQPWKTEQDFWRLYESKYTLLLEKARSYLGNQAWRLKELGQVPKAAIFFSAGFDASEWESAGMQRHQV
NVPTEFYARIAQDVVKIAAEPGLYVDGRIVSVLEGGYSDRALASGVMSHLSGLVGDQSPGNRPNGATVPWHLARN
AASHVHRPLGSLHAYDASWWASGQLDKLENPPEPPSPPRKPRNTTPPTYCSPTQASTAKVVDPAKMRRSLSGLYS
ARPAERVPTPPPPQVSWVVAAHELSKLLIPSDRQTSSCRPEDLNAEATKARRDRQSNLMGVIATPPEPLPSHPTS
KMALRERKAKPPAPVDEEFVQQRAKTRRKTVALVPTPLTKTLSGSTPPIPSVRPGPVVRRTSRRLSGESAAPGAS
RDGGSQSSKSNTTMSRPTSAMSSRTQSTGKLAIKKTRTTAGARRDGAAKATSSPKKAAVQTKATKSQALSSRPST
ATSVMSHDVGDAMENITSGMRKIRINLITESQREAKAQARLETDKMATWQGQDGSPRDGSPRLVPTTVKQDEMSA
EPVNHSESLASSVPAMSQASTADQGSTYSSLPDDVAEVPERPHTPHGKTFTARRDTPDARQCGVQAANFAQRPTA
TLSAGESDACFIHYQPAGPQPVAVEQQSSLTWLRPNTSTPFTGSPVDTPNPAEKNGNLFRYTSGIPFAPAPQSAG
TPAPLNGTQDVDETKADNLTASVWEVPETPKK*
Coding >OphauG2|446
ATGCAGTCGCCCGCTACACCTGTGCCTGCGCAACCGTCGCCGCCTCGGCACAGCCAGACGGCGGCAAACGCGACT
GATGAGGGCGACTGCTTGGCCGATTCACTGCTCCAGCTTTCGCTGTCAAGCAAGATGATGTCGACGCCGCCAAAA
CGCCCGTCGTCGCGCCGCTCCTCTGGGCTTTCGGCCGATCCACGACGCCCTTCTCACAGCCCCTTTCAGGCACAA
GAAGCGCGCACCACTTCGCCCCCTGGAGTCCGCTACAGGGCGTCGGCCTCGTCGTTGCGCTCGCTGGGAATCGCC
GCCCCGCCGACGCGTGGCTCCATGTCGCGCCGCTCGAGCTCGGCCCAGGTCATGTCGCCCACTGCCATCAGGACT
GTCTCGGCCAGCCACGACGAGGAGAAGCCATTTGTCACTGCAAACTCGCTGGCGAGAAACCACTTGCAGGCCGAG
CTGGCCTCGCTCCATGGAATCCTCTCCCCCCTGCCCACCGAGACCATTGTTGTCCTCAACGATGCTGTCTACGGC
CATCGCTACGCACGGCCTCGCACCTCACGCAGCGCTCTGAGCACCATTGTCGAGCGCCCCGAGAGGATCAAGGCT
ACTGTCCTGGGCATTTCAACGGCATATGTGCGCCTGGGCGGCCGCCATGAACACGGCTCCAACCCCATCCAACCC
GACGCCAGCACCCACTCACTCACAGGCATTCCCTTTCGCATCCACAAGACGACTCGCCGCCTCCCTCTGGCATCG
CCCGCCGTGACCAATGTCCATGGCTCCAAATGGATGGAGGAGCTCAAGATGATGTGTGACTCGGCCGAGGCCAAG
CTTGCCATGGGAGGCAAAGAGCTTCAGCGGCCCGACATGTATAGGGGCCCAGATGCCGAGCCGCCGCAAAAGCTT
CACCAAGGCGACCTGTACTTGTGCTCCGAGTCTCTGGATGCCATGGAAGGCGCTCTGGGCGCTGTGTGCGAAGCC
GTGGATGCCGTCTTTACATCTCCGCATCGACGCGCCTTTGTTGGCGCACGGCCACCAGGACACCACTGCTCGGCC
TCTCACCCATCCGGCTTTTGCTGGGTCAACAATGTCCACATTGGCATCATGCACGCCGCCCTGGCCCATGGTCTC
ACCCACGCCGTCATTATAGACTTTGATCTACACCACGGAGACGGTTCCCAGGACATCACCTGGAAGCACAATTCG
CGGGCCAGACTTGCCGCCAAGAACGCATCGGCCTGGAAAAAGACTTCAATAGGCTATTTCAGCCTGCACGATATC
AACTCGTATCCTTGCGAGTATGGAGACGACGAAAAGGTGCAGAGTGCAAGCCTCTGTATCGACAATGCGCATGCA
CAAACGATTTGGAATATTCACCTGCAGCCATGGAAGACTGAGCAGGACTTTTGGCGACTGTACGAGTCCAAGTAC
ACCCTTCTTCTGGAAAAGGCGCGCTCCTATCTTGGCAACCAAGCCTGGCGCTTGAAGGAGCTTGGCCAGGTGCCC
AAGGCAGCCATTTTCTTTTCCGCTGGTTTTGATGCTAGCGAGTGGGAAAGCGCAGGCATGCAGCGCCACCAGGTC
AACGTGCCGACCGAGTTCTATGCCAGGATTGCACAAGACGTTGTCAAGATTGCTGCAGAGCCAGGCCTCTATGTC
GATGGCCGGATCGTCAGCGTCTTGGAGGGCGGCTACAGCGACAGAGCCCTGGCTTCGGGCGTCATGAGCCATCTC
AGCGGCCTTGTCGGAGACCAATCACCTGGAAACAGACCCAACGGAGCAACAGTTCCATGGCATCTGGCACGCAAT
GCGGCTTCTCACGTGCACCGGCCGCTGGGGTCGCTTCATGCGTATGATGCGTCGTGGTGGGCAAGTGGACAGCTG
GACAAGCTTGAAAACCCTCCTGAGCCACCCTCGCCTCCGCGAAAACCACGCAACACCACGCCGCCCACATACTGC
TCGCCAACGCAGGCCTCGACGGCAAAGGTGGTGGATCCTGCCAAGATGAGACGAAGCTTGTCGGGGCTGTATTCT
GCACGGCCCGCTGAGAGAGTGCCGACGCCGCCGCCACCCCAAGTATCATGGGTCGTGGCAGCCCACGAACTGTCT
AAGCTGCTTATTCCGTCTGATCGTCAGACCAGCAGCTGCAGGCCAGAAGACCTCAATGCAGAGGCGACCAAGGCT
CGACGAGACCGCCAGTCCAACTTGATGGGTGTCATTGCCACTCCCCCTGAGCCGCTGCCCAGCCATCCGACGTCG
AAAATGGCTCTTCGCGAACGCAAGGCCAAGCCTCCGGCTCCTGTTGACGAGGAGTTTGTGCAACAGCGCGCCAAG
ACGAGACGAAAGACTGTTGCCCTTGTTCCGACGCCTTTGACCAAGACTTTGTCTGGCAGCACGCCGCCTATTCCA
AGCGTTCGCCCGGGTCCTGTAGTCAGGAGGACAAGTAGACGCCTTAGTGGAGAGTCTGCTGCACCCGGCGCATCC
AGGGACGGGGGCTCACAAAGCTCCAAGAGCAACACCACCATGAGCCGCCCCACATCAGCCATGAGCTCTAGAACA
CAGAGCACTGGCAAGTTGGCCATTAAGAAGACGCGGACGACGGCTGGTGCGCGCAGAGACGGCGCGGCCAAAGCC
ACTAGCAGTCCAAAGAAGGCTGCTGTTCAAACAAAGGCCACCAAATCTCAAGCATTGTCATCGAGACCCTCGACA
GCCACCAGTGTCATGTCACACGATGTGGGAGACGCAATGGAGAATATTACGAGCGGCATGAGGAAGATACGAATC
AACCTGATTACTGAGTCGCAGAGAGAGGCCAAGGCACAAGCCCGACTGGAGACTGACAAGATGGCCACTTGGCAG
GGGCAAGACGGCAGCCCTCGAGACGGCAGCCCTCGACTGGTGCCGACGACGGTGAAGCAGGATGAAATGAGCGCC
GAGCCCGTGAATCACTCTGAATCACTGGCCTCTAGTGTCCCAGCCATGAGCCAAGCAAGCACTGCGGATCAAGGG
TCGACATATTCATCTTTGCCTGATGATGTAGCTGAAGTGCCCGAAAGACCTCATACGCCACATGGCAAGACATTC
ACAGCGAGAAGAGACACACCGGATGCTCGGCAATGTGGGGTGCAAGCGGCCAACTTTGCCCAAAGGCCCACGGCT
ACGCTGTCGGCAGGTGAATCGGATGCTTGCTTTATTCACTATCAACCCGCGGGGCCGCAGCCAGTGGCAGTGGAG
CAACAATCGTCTCTGACATGGCTTCGTCCCAACACGTCTACCCCGTTTACAGGCAGTCCAGTGGATACGCCGAAT
CCAGCTGAAAAGAATGGGAACCTGTTCCGGTATACCTCTGGTATTCCTTTTGCGCCAGCACCGCAAAGCGCCGGG
ACCCCAGCACCTCTAAATGGGACCCAGGATGTTGACGAGACCAAGGCGGATAACTTGACAGCATCAGTATGGGAG
GTGCCAGAAACACCAAAGAAATAG
Transcript >OphauG2|446
ATGCAGTCGCCCGCTACACCTGTGCCTGCGCAACCGTCGCCGCCTCGGCACAGCCAGACGGCGGCAAACGCGACT
GATGAGGGCGACTGCTTGGCCGATTCACTGCTCCAGCTTTCGCTGTCAAGCAAGATGATGTCGACGCCGCCAAAA
CGCCCGTCGTCGCGCCGCTCCTCTGGGCTTTCGGCCGATCCACGACGCCCTTCTCACAGCCCCTTTCAGGCACAA
GAAGCGCGCACCACTTCGCCCCCTGGAGTCCGCTACAGGGCGTCGGCCTCGTCGTTGCGCTCGCTGGGAATCGCC
GCCCCGCCGACGCGTGGCTCCATGTCGCGCCGCTCGAGCTCGGCCCAGGTCATGTCGCCCACTGCCATCAGGACT
GTCTCGGCCAGCCACGACGAGGAGAAGCCATTTGTCACTGCAAACTCGCTGGCGAGAAACCACTTGCAGGCCGAG
CTGGCCTCGCTCCATGGAATCCTCTCCCCCCTGCCCACCGAGACCATTGTTGTCCTCAACGATGCTGTCTACGGC
CATCGCTACGCACGGCCTCGCACCTCACGCAGCGCTCTGAGCACCATTGTCGAGCGCCCCGAGAGGATCAAGGCT
ACTGTCCTGGGCATTTCAACGGCATATGTGCGCCTGGGCGGCCGCCATGAACACGGCTCCAACCCCATCCAACCC
GACGCCAGCACCCACTCACTCACAGGCATTCCCTTTCGCATCCACAAGACGACTCGCCGCCTCCCTCTGGCATCG
CCCGCCGTGACCAATGTCCATGGCTCCAAATGGATGGAGGAGCTCAAGATGATGTGTGACTCGGCCGAGGCCAAG
CTTGCCATGGGAGGCAAAGAGCTTCAGCGGCCCGACATGTATAGGGGCCCAGATGCCGAGCCGCCGCAAAAGCTT
CACCAAGGCGACCTGTACTTGTGCTCCGAGTCTCTGGATGCCATGGAAGGCGCTCTGGGCGCTGTGTGCGAAGCC
GTGGATGCCGTCTTTACATCTCCGCATCGACGCGCCTTTGTTGGCGCACGGCCACCAGGACACCACTGCTCGGCC
TCTCACCCATCCGGCTTTTGCTGGGTCAACAATGTCCACATTGGCATCATGCACGCCGCCCTGGCCCATGGTCTC
ACCCACGCCGTCATTATAGACTTTGATCTACACCACGGAGACGGTTCCCAGGACATCACCTGGAAGCACAATTCG
CGGGCCAGACTTGCCGCCAAGAACGCATCGGCCTGGAAAAAGACTTCAATAGGCTATTTCAGCCTGCACGATATC
AACTCGTATCCTTGCGAGTATGGAGACGACGAAAAGGTGCAGAGTGCAAGCCTCTGTATCGACAATGCGCATGCA
CAAACGATTTGGAATATTCACCTGCAGCCATGGAAGACTGAGCAGGACTTTTGGCGACTGTACGAGTCCAAGTAC
ACCCTTCTTCTGGAAAAGGCGCGCTCCTATCTTGGCAACCAAGCCTGGCGCTTGAAGGAGCTTGGCCAGGTGCCC
AAGGCAGCCATTTTCTTTTCCGCTGGTTTTGATGCTAGCGAGTGGGAAAGCGCAGGCATGCAGCGCCACCAGGTC
AACGTGCCGACCGAGTTCTATGCCAGGATTGCACAAGACGTTGTCAAGATTGCTGCAGAGCCAGGCCTCTATGTC
GATGGCCGGATCGTCAGCGTCTTGGAGGGCGGCTACAGCGACAGAGCCCTGGCTTCGGGCGTCATGAGCCATCTC
AGCGGCCTTGTCGGAGACCAATCACCTGGAAACAGACCCAACGGAGCAACAGTTCCATGGCATCTGGCACGCAAT
GCGGCTTCTCACGTGCACCGGCCGCTGGGGTCGCTTCATGCGTATGATGCGTCGTGGTGGGCAAGTGGACAGCTG
GACAAGCTTGAAAACCCTCCTGAGCCACCCTCGCCTCCGCGAAAACCACGCAACACCACGCCGCCCACATACTGC
TCGCCAACGCAGGCCTCGACGGCAAAGGTGGTGGATCCTGCCAAGATGAGACGAAGCTTGTCGGGGCTGTATTCT
GCACGGCCCGCTGAGAGAGTGCCGACGCCGCCGCCACCCCAAGTATCATGGGTCGTGGCAGCCCACGAACTGTCT
AAGCTGCTTATTCCGTCTGATCGTCAGACCAGCAGCTGCAGGCCAGAAGACCTCAATGCAGAGGCGACCAAGGCT
CGACGAGACCGCCAGTCCAACTTGATGGGTGTCATTGCCACTCCCCCTGAGCCGCTGCCCAGCCATCCGACGTCG
AAAATGGCTCTTCGCGAACGCAAGGCCAAGCCTCCGGCTCCTGTTGACGAGGAGTTTGTGCAACAGCGCGCCAAG
ACGAGACGAAAGACTGTTGCCCTTGTTCCGACGCCTTTGACCAAGACTTTGTCTGGCAGCACGCCGCCTATTCCA
AGCGTTCGCCCGGGTCCTGTAGTCAGGAGGACAAGTAGACGCCTTAGTGGAGAGTCTGCTGCACCCGGCGCATCC
AGGGACGGGGGCTCACAAAGCTCCAAGAGCAACACCACCATGAGCCGCCCCACATCAGCCATGAGCTCTAGAACA
CAGAGCACTGGCAAGTTGGCCATTAAGAAGACGCGGACGACGGCTGGTGCGCGCAGAGACGGCGCGGCCAAAGCC
ACTAGCAGTCCAAAGAAGGCTGCTGTTCAAACAAAGGCCACCAAATCTCAAGCATTGTCATCGAGACCCTCGACA
GCCACCAGTGTCATGTCACACGATGTGGGAGACGCAATGGAGAATATTACGAGCGGCATGAGGAAGATACGAATC
AACCTGATTACTGAGTCGCAGAGAGAGGCCAAGGCACAAGCCCGACTGGAGACTGACAAGATGGCCACTTGGCAG
GGGCAAGACGGCAGCCCTCGAGACGGCAGCCCTCGACTGGTGCCGACGACGGTGAAGCAGGATGAAATGAGCGCC
GAGCCCGTGAATCACTCTGAATCACTGGCCTCTAGTGTCCCAGCCATGAGCCAAGCAAGCACTGCGGATCAAGGG
TCGACATATTCATCTTTGCCTGATGATGTAGCTGAAGTGCCCGAAAGACCTCATACGCCACATGGCAAGACATTC
ACAGCGAGAAGAGACACACCGGATGCTCGGCAATGTGGGGTGCAAGCGGCCAACTTTGCCCAAAGGCCCACGGCT
ACGCTGTCGGCAGGTGAATCGGATGCTTGCTTTATTCACTATCAACCCGCGGGGCCGCAGCCAGTGGCAGTGGAG
CAACAATCGTCTCTGACATGGCTTCGTCCCAACACGTCTACCCCGTTTACAGGCAGTCCAGTGGATACGCCGAAT
CCAGCTGAAAAGAATGGGAACCTGTTCCGGTATACCTCTGGTATTCCTTTTGCGCCAGCACCGCAAAGCGCCGGG
ACCCCAGCACCTCTAAATGGGACCCAGGATGTTGACGAGACCAAGGCGGATAACTTGACAGCATCAGTATGGGAG
GTGCCAGAAACACCAAAGAAATAG
Gene >OphauG2|446
ATGCAGTCGCCCGCTACACCTGTGCCTGCGCAACCGTCGCCGCCTCGGCACAGCCAGACGGCGGCAAACGCGACT
GATGAGGGCGACTGCTTGGCCGATTCACTGCTCCAGCTTTCGCTGTCAAGCAAGATGATGTCGACGCCGCCAAAA
CGCCCGTCGTCGCGCCGCTCCTCTGGGCTTTCGGCCGATCCACGACGCCCTTCTCACAGCCCCTTTCAGGCACAA
GAAGCGCGCACCACTTCGCCCCCTGGAGTCCGCTACAGGGCGTCGGCCTCGTCGTTGCGCTCGCTGGGAATCGCC
GCCCCGCCGACGCGTGGCTCCATGTCGCGCCGCTCGAGCTCGGCCCAGGTCATGTCGCCCACTGCCATCAGGACT
GTCTCGGCCAGCCACGACGAGGAGAAGCCATTTGTCACTGCAAACTCGCTGGCGAGAAACCACTTGCAGGCCGAG
CTGGCCTCGCTCCATGGAATCCTCTCCCCCCTGCCCACCGAGACCATTGTTGTCCTCAACGATGCTGTCTACGGC
CATCGCTACGCACGGCCTCGCACCTCACGCAGCGCTCTGAGCACCATTGTCGAGCGCCCCGAGAGGATCAAGGCT
ACTGTCCTGGGCATTTCAACGGCATATGTGCGCCTGGGCGGCCGCCATGAACACGGCTCCAACCCCATCCAACCC
GACGCCAGCACCCACTCACTCACAGGCATTCCCTTTCGCATCCACAAGACGACTCGCCGCCTCCCTCTGGCATCG
CCCGCCGTGACCAATGTCCATGGCTCCAAATGGATGGAGGAGCTCAAGATGATGTGTGACTCGGCCGAGGCCAAG
CTTGCCATGGGAGGCAAAGAGCTTCAGCGGCCCGACATGTATAGGGGCCCAGATGCCGAGCCGCCGCAAAAGCTT
CACCAAGGCGACCTGTACTTGTGCTCCGAGTCTCTGGATGCCATGGAAGGCGCTCTGGGCGCTGTGTGCGAAGCC
GTGGATGCCGTCTTTACATCTCCGCATCGACGCGCCTTTGTTGGCGCACGGCCACCAGGACACCACTGCTCGGCC
TCTCACCCATCCGGCTTTTGCTGGGTCAACAATGTCCACATTGGCATCATGCACGCCGCCCTGGCCCATGGTCTC
ACCCACGCCGTCATTATAGACTTTGATCTACACCACGGAGACGGTTCCCAGGACATCACCTGGAAGCACAATTCG
CGGGCCAGACTTGCCGCCAAGAACGCATCGGCCTGGAAAAAGACTTCAATAGGCTATTTCAGCCTGCACGATATC
AACTCGTATCCTTGCGAGTATGGAGACGACGAAAAGGTGCAGAGTGCAAGCCTCTGTATCGACAATGCGCATGCA
CAAACGATTTGGAATATTCACCTGCAGCCATGGAAGACTGAGCAGGACTTTTGGCGACTGTACGAGTCCAAGTAC
ACCCTTCTTCTGGAAAAGGCGCGCTCCTATCTTGGCAACCAAGCCTGGCGCTTGAAGGAGCTTGGCCAGGTGCCC
AAGGCAGCCATTTTCTTTTCCGCTGGTTTTGATGCTAGCGAGTGGGAAAGCGCAGGCATGCAGCGCCACCAGGTC
AACGTGCCGACCGAGTTCTATGCCAGGATTGCACAAGACGTTGTCAAGATTGCTGCAGAGCCAGGCCTCTATGTC
GATGGCCGGATCGTCAGCGTCTTGGAGGGCGGCTACAGCGACAGAGCCCTGGCTTCGGGCGTCATGAGCCATCTC
AGCGGCCTTGTCGGAGACCAATCACCTGGAAACAGACCCAACGGAGCAACAGTTCCATGGCATCTGGCACGCAAT
GCGGCTTCTCACGTGCACCGGCCGCTGGGGTCGCTTCATGCGTATGATGCGTCGTGGTGGGCAAGTGGACAGCTG
GACAAGCTTGAAAACCCTCCTGAGCCACCCTCGCCTCCGCGAAAACCACGCAACACCACGCCGCCCACATACTGC
TCGCCAACGCAGGCCTCGACGGCAAAGGTGGTGGATCCTGCCAAGATGAGACGAAGCTTGTCGGGGCTGTATTCT
GCACGGCCCGCTGAGAGAGTGCCGACGCCGCCGCCACCCCAAGTATCATGGGTCGTGGCAGCCCACGAACTGTCT
AAGCTGCTTATTCCGTCTGATCGTCAGACCAGCAGCTGCAGGCCAGAAGACCTCAATGCAGAGGCGACCAAGGCT
CGACGAGACCGCCAGTCCAACTTGATGGGTGTCATTGCCACTCCCCCTGAGCCGCTGCCCAGCCATCCGACGTCG
AAAATGGCTCTTCGCGAACGCAAGGCCAAGCCTCCGGCTCCTGTTGACGAGGAGTTTGTGCAACAGCGCGCCAAG
ACGAGACGAAAGACTGTTGCCCTTGTTCCGACGCCTTTGACCAAGGTAGGACAGCCACAACGGGACAAGGCGCAA
GCAGTGGAGGCTGATGCGAGTAACCATGATCAGACTTTGTCTGGCAGCACGCCGCCTATTCCAAGCGTTCGCCCG
GGTCCTGTAGTCAGGAGGACAAGTAGACGCCTTAGTGGAGAGTCTGCTGCACCCGGCGCATCCAGGGACGGGGGC
TCACAAAGCTCCAAGAGCAACACCACCATGAGCCGCCCCACATCAGCCATGAGCTCTAGAACACAGAGCACTGGC
AAGTTGGCCATTAAGAAGACGCGGACGACGGCTGGTGCGCGCAGAGACGGCGCGGCCAAAGCCACTAGCAGTCCA
AAGAAGGCTGCTGTTCAAACAAAGGCCACCAAATCTCAAGCATTGTCATCGAGACCCTCGACAGCCACCAGTGTC
ATGTCACACGATGTGGGAGACGCAATGGAGAATATTACGAGCGGCATGAGGAAGATACGAATCAACCTGATTACT
GAGTCGCAGAGAGAGGCCAAGGCACAAGCCCGACTGGAGACTGACAAGATGGCCACTTGGCAGGGGCAAGACGGC
AGCCCTCGAGACGGCAGCCCTCGACTGGTGCCGACGACGGTGAAGCAGGATGAAATGAGCGCCGAGCCCGTGAAT
CACTCTGAATCACTGGCCTCTAGTGTCCCAGCCATGAGCCAAGCAAGCACTGCGGATCAAGGGTCGACATATTCA
TCTTTGCCTGATGATGTAGCTGAAGTGCCCGAAAGACCTCATACGCCACATGGCAAGACATTCACAGCGAGAAGA
GACACACCGGATGCTCGGCAATGTGGGGTGCAAGCGGCCAACTTTGCCCAAAGGCCCACGGCTACGCTGTCGGCA
GGTGAATCGGATGCTTGCTTTATTCACTATCAACCCGCGGGGCCGCAGCCAGTGGCAGTGGAGCAACAATCGTCT
CTGACATGGCTTCGTCCCAACACGTCTACCCCGTTTACAGGCAGTCCAGTGGATACGCCGAATCCAGCTGAAAAG
AATGGGAACCTGTTCCGGTATACCTCTGGTATTCCTTTTGCGCCAGCACCGCAAAGCGCCGGGACCCCAGCACCT
CTAAATGGGACCCAGGATGTTGACGAGACCAAGGCGGATAACTTGACAGCATCAGTATGGGAGGTGCCAGAAACA
CCAAAGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail