Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4455
Gene name
LocationContig_373:9242..9725
Strand-
Gene length (bp)483
Transcript length (bp)429
Coding sequence length (bp)429
Protein length (aa) 143

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12658 Ten1 Telomere capping, CST complex subunit 1.2E-27 4 122

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0043047 single-stranded telomeric DNA binding Yes
GO:0016233 telomere capping Yes
GO:1990879 CST complex Yes
GO:0006259 DNA metabolic process No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043565 sequence-specific DNA binding No
GO:0016043 cellular component organization No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0051276 chromosome organization No
GO:0003676 nucleic acid binding No
GO:0098847 sequence-specific single stranded DNA binding No
GO:0008150 biological_process No
GO:0006996 organelle organization No
GO:0044815 DNA packaging complex No
GO:0000782 telomere cap complex No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140513 nuclear protein-containing complex No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0000783 nuclear telomere cap complex No
GO:0003677 DNA binding No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0000723 telomere maintenance No
GO:0003674 molecular_function No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0071840 cellular component organization or biogenesis No
GO:0003697 single-stranded DNA binding No
GO:0006807 nitrogen compound metabolic process No
GO:0032200 telomere organization No
GO:0032993 protein-DNA complex No
GO:0043170 macromolecule metabolic process No
GO:0042162 telomeric DNA binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6310
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4455 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7102
Ophiocordyceps camponoti-floridani Ophcf2|05439
Ophiocordyceps kimflemingae Ophio5|7681
Ophiocordyceps subramaniannii Hirsu2|9294

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4455
MSSRGPLPSQLCLLSSLPDRCKGEKVRFLGCVTSYSTASAVLELGHLYPADTNVTVSVNVQLVLETLPSQLTRIG
EWVNVIGYVVETSKAAATGPDSSSAHIQALVIWPTGPLNIQLYEKELEESDSVQSRVTTCEATGRLC*
Coding >OphauG2|4455
ATGTCCAGTAGGGGCCCTTTGCCCTCTCAGCTTTGCCTCTTGTCTTCACTGCCAGACAGGTGCAAAGGAGAAAAA
GTCCGCTTCCTGGGCTGTGTCACCTCCTACTCGACGGCGTCGGCCGTGCTGGAGCTTGGCCACCTCTATCCCGCA
GACACCAATGTGACAGTCTCGGTCAACGTGCAGCTGGTTCTGGAGACACTGCCATCGCAGCTGACGCGCATCGGC
GAATGGGTCAATGTCATCGGCTACGTGGTGGAAACATCCAAGGCTGCAGCCACGGGTCCAGACTCTTCATCTGCG
CATATCCAGGCACTTGTAATATGGCCCACAGGACCACTCAATATTCAGCTCTATGAAAAGGAGCTGGAAGAAAGT
GATAGCGTCCAGTCACGGGTCACGACCTGCGAGGCAACGGGACGACTATGCTAG
Transcript >OphauG2|4455
ATGTCCAGTAGGGGCCCTTTGCCCTCTCAGCTTTGCCTCTTGTCTTCACTGCCAGACAGGTGCAAAGGAGAAAAA
GTCCGCTTCCTGGGCTGTGTCACCTCCTACTCGACGGCGTCGGCCGTGCTGGAGCTTGGCCACCTCTATCCCGCA
GACACCAATGTGACAGTCTCGGTCAACGTGCAGCTGGTTCTGGAGACACTGCCATCGCAGCTGACGCGCATCGGC
GAATGGGTCAATGTCATCGGCTACGTGGTGGAAACATCCAAGGCTGCAGCCACGGGTCCAGACTCTTCATCTGCG
CATATCCAGGCACTTGTAATATGGCCCACAGGACCACTCAATATTCAGCTCTATGAAAAGGAGCTGGAAGAAAGT
GATAGCGTCCAGTCACGGGTCACGACCTGCGAGGCAACGGGACGACTATGCTAG
Gene >OphauG2|4455
ATGTCCAGTAGGGGCCCTTTGCCCTCTCAGCTTTGCCTCTTGTCTTCACTGCCAGACAGGTGCAAAGGAGAAAAA
GTCCGCTTCCTGGGCTGGTATGAGGCGCCCTGCGACCTAAATGGCCTTACTGTGTACTGAGCCCTCTGCAGTGTC
ACCTCCTACTCGACGGCGTCGGCCGTGCTGGAGCTTGGCCACCTCTATCCCGCAGACACCAATGTGACAGTCTCG
GTCAACGTGCAGCTGGTTCTGGAGACACTGCCATCGCAGCTGACGCGCATCGGCGAATGGGTCAATGTCATCGGC
TACGTGGTGGAAACATCCAAGGCTGCAGCCACGGGTCCAGACTCTTCATCTGCGCATATCCAGGCACTTGTAATA
TGGCCCACAGGACCACTCAATATTCAGCTCTATGAAAAGGAGCTGGAAGAAAGTGATAGCGTCCAGTCACGGGTC
ACGACCTGCGAGGCAACGGGACGACTATGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail