Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4449
Gene name
LocationContig_372:6538..7657
Strand-
Gene length (bp)1119
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 9.6E-48 14 284
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.3E-25 13 235
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 1.9E-16 14 234
PF07993 NAD_binding_4 Male sterility protein 4.1E-08 78 189
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 7.4E-05 13 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 13 363 7.0E-48
sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 14 354 9.0E-41
sp|Q67ZE1|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana GN=3BETAHSD/D2 PE=2 SV=2 14 354 4.0E-39
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 15 363 1.0E-38
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg26 PE=3 SV=1 10 365 4.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 13 363 7.0E-48
sp|Q9FX01|HSDD1_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 1 OS=Arabidopsis thaliana GN=3BETAHSD/D1 PE=2 SV=1 14 354 9.0E-41
sp|Q67ZE1|HSDD2_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 2 OS=Arabidopsis thaliana GN=3BETAHSD/D2 PE=2 SV=2 14 354 4.0E-39
sp|Q3ZBE9|NSDHL_BOVIN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Bos taurus GN=NSDHL PE=2 SV=1 15 363 1.0E-38
sp|O43050|ERG26_SCHPO Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg26 PE=3 SV=1 10 365 4.0E-38
sp|Q9R1J0|NSDHL_MOUSE Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Mus musculus GN=Nsdhl PE=1 SV=1 15 355 5.0E-38
sp|Q15738|NSDHL_HUMAN Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Homo sapiens GN=NSDHL PE=1 SV=2 6 363 3.0E-36
sp|Q5PPL3|NSDHL_RAT Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Nsdhl PE=2 SV=1 15 355 2.0E-31
sp|Q8WUS8|D42E1_HUMAN Short-chain dehydrogenase/reductase family 42E member 1 OS=Homo sapiens GN=SDR42E1 PE=2 SV=2 13 369 1.0E-29
sp|Q4R7R1|D42E1_MACFA Short-chain dehydrogenase/reductase family 42E member 1 OS=Macaca fascicularis GN=SDR42E1 PE=2 SV=1 13 369 2.0E-29
sp|A8DZE7|D42E1_DANRE Short-chain dehydrogenase/reductase family 42E member 1 OS=Danio rerio GN=sdr42e1 PE=2 SV=1 14 372 7.0E-29
sp|Q32L94|D42E1_BOVIN Short-chain dehydrogenase/reductase family 42E member 1 OS=Bos taurus GN=SDR42E1 PE=2 SV=2 13 368 2.0E-27
sp|Q9D665|D42E1_MOUSE Short-chain dehydrogenase/reductase family 42E member 1 OS=Mus musculus GN=Sdr42e1 PE=1 SV=1 13 362 4.0E-27
sp|A9X4U2|HSDD3_ARATH 3beta-hydroxysteroid-dehydrogenase/decarboxylase isoform 3 OS=Arabidopsis thaliana GN=3BETAHSD/D3 PE=2 SV=2 10 367 6.0E-26
sp|P9WQP7|3BHS_MYCTU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1106c PE=1 SV=1 9 354 3.0E-23
sp|P9WQP6|3BHS_MYCTO 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1137 PE=3 SV=1 9 354 3.0E-23
sp|Q0IH73|D42E1_XENLA Short-chain dehydrogenase/reductase family 42E member 1 OS=Xenopus laevis GN=sdr42e1 PE=2 SV=1 6 372 8.0E-23
sp|A6NKP2|D42E2_HUMAN Putative short-chain dehydrogenase/reductase family 42E member 2 OS=Homo sapiens GN=SDR42E2 PE=3 SV=3 2 346 6.0E-22
sp|Q9H2F3|3BHS7_HUMAN 3 beta-hydroxysteroid dehydrogenase type 7 OS=Homo sapiens GN=HSD3B7 PE=1 SV=2 14 352 2.0E-19
sp|P22071|3BHS1_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Rattus norvegicus GN=Hsd3b1 PE=2 SV=3 14 360 9.0E-19
sp|P22072|3BHS2_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Rattus norvegicus GN=Hsd3b PE=2 SV=3 14 360 1.0E-18
sp|Q62878|3BHS4_RAT 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 4 OS=Rattus norvegicus GN=Hsd3b6 PE=2 SV=4 14 360 1.0E-18
sp|Q64421|3BHS2_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Mesocricetus auratus GN=HSD3B2 PE=2 SV=3 14 360 3.0E-18
sp|P26149|3BHS2_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Mus musculus GN=Hsd3b2 PE=1 SV=4 14 360 4.0E-18
sp|P24815|3BHS1_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Mus musculus GN=Hsd3b1 PE=1 SV=3 14 360 1.0E-17
sp|Q67477|3BHS_FOWPN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Fowlpox virus (strain NVSL) GN=FPV046 PE=3 SV=2 14 369 6.0E-17
sp|P27365|3BHS1_MACMU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Macaca mulatta GN=HSD3B1 PE=2 SV=2 14 370 7.0E-17
sp|P26150|3BHS3_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 3 OS=Mus musculus GN=Hsd3b3 PE=1 SV=3 14 360 8.0E-17
sp|P26439|3BHS2_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 2 OS=Homo sapiens GN=HSD3B2 PE=1 SV=2 98 370 1.0E-16
sp|Q9EQC1|3BHS7_MOUSE 3 beta-hydroxysteroid dehydrogenase type 7 OS=Mus musculus GN=Hsd3b7 PE=1 SV=1 14 366 1.0E-16
sp|P14060|3BHS1_HUMAN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Homo sapiens GN=HSD3B1 PE=1 SV=2 98 370 1.0E-16
sp|Q5IFP1|3BHS_CANLF 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Canis lupus familiaris GN=HSD3B PE=2 SV=3 98 360 1.0E-16
sp|Q60555|3BHS1_MESAU 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 OS=Mesocricetus auratus GN=HSD3B1 PE=2 SV=3 14 360 4.0E-16
sp|Q6GZS4|052L_FRG3G Uncharacterized protein 052L OS=Frog virus 3 (isolate Goorha) GN=FV3-052L PE=3 SV=1 10 360 9.0E-16
sp|O35469|3BHS6_MOUSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 6 OS=Mus musculus GN=Hsd3b6 PE=1 SV=4 14 360 5.0E-15
sp|Q9N119|3BHS_PIG 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Sus scrofa GN=HSD3B PE=2 SV=4 14 372 4.0E-14
sp|P14893|3BHS_BOVIN 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Bos taurus GN=HSD3B PE=1 SV=2 98 360 2.0E-13
sp|O46516|3BHS_HORSE 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Equus caballus GN=HSD3B PE=2 SV=3 98 360 7.0E-13
sp|P27364|3BHS5_RAT 3 beta-hydroxysteroid dehydrogenase type 5 OS=Rattus norvegicus GN=Hsd3b5 PE=2 SV=3 14 360 2.0E-12
sp|Q61767|3BHS4_MOUSE 3 beta-hydroxysteroid dehydrogenase type 4 OS=Mus musculus GN=Hsd3b4 PE=1 SV=3 14 360 3.0E-11
sp|O35048|3BHS7_RAT 3 beta-hydroxysteroid dehydrogenase type 7 OS=Rattus norvegicus GN=Hsd3b7 PE=2 SV=1 14 366 3.0E-10
sp|O35296|3BHS3_MESAU 3 beta-hydroxysteroid dehydrogenase type 3 OS=Mesocricetus auratus GN=HSD3B3 PE=2 SV=3 14 360 3.0E-10
sp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 13 230 1.0E-08
sp|Q9SYM5|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 13 230 1.0E-08
sp|P26670|3BHS_VACCW 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase OS=Vaccinia virus (strain Western Reserve) GN=VACWR170 PE=3 SV=1 10 365 2.0E-08
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 13 286 2.0E-08
sp|P37759|RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) GN=rfbB PE=3 SV=2 13 224 3.0E-08
sp|Q9FIE8|UXS3_ARATH UDP-glucuronic acid decarboxylase 3 OS=Arabidopsis thaliana GN=UXS3 PE=1 SV=1 13 232 5.0E-08
sp|Q9ZV36|UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana GN=UXS6 PE=2 SV=1 13 230 6.0E-08
sp|Q9SN95|UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana GN=UXS5 PE=2 SV=1 13 230 1.0E-07
sp|P55579|Y4NG_RHISN Uncharacterized protein y4nG OS=Rhizobium sp. (strain NGR234) GN=NGR_a02350 PE=3 SV=1 14 370 2.0E-07
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 13 224 6.0E-07
sp|P75517|GALE_MYCPN UDP-glucose 4-epimerase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=galE PE=3 SV=1 8 270 7.0E-07
sp|P44914|RMLB_HAEIN dTDP-glucose 4,6-dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rffG PE=3 SV=1 10 233 9.0E-07
sp|Q04871|YCL2_ECO11 Uncharacterized 37.6 kDa protein in cld 5'region OS=Escherichia coli O111:H- PE=3 SV=1 14 363 1.0E-06
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 13 233 1.0E-06
sp|P55294|RMLB_NEIMB dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rfbB1 PE=3 SV=2 10 112 3.0E-06
sp|P75821|YBJS_ECOLI Uncharacterized protein YbjS OS=Escherichia coli (strain K12) GN=ybjS PE=3 SV=2 13 364 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0006694 steroid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0008202 steroid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0016229 steroid dehydrogenase activity No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4449
MSARDNQDSMSPVLITGGCGFIGFHMTKHILQTEADCSIHVVDINTTHNTLPGVDYHNIDMADANSLQTIVVKVK
PRTIFHIASPDPMVVLPSRFKAVNVDGTRNLLSACEAAGTVGAFVNTSTSSVIHDNVSDLVNAGEELPIVQYPQQ
KRAYTLTKAVAEGLVLAANRAHGDGSMLTANLRPATVFGERDSICMGRIVAVCRAGRGDMQIGPGDNEYDFVYVG
NLVDAQILTAKALLRAYGKPPPAPDTRVDGQSFNITNDERILFWDFQRAVSASVGLPITKDKIKIVSPWLLLLIA
FISEWTTWLRSFGTKQPMFTREAVWLTTITRTLNGDKAKRVLGYKPRYSIKEGLDIAGKWFREEEAKRSKDN*
Coding >OphauG2|4449
ATGTCTGCAAGAGATAACCAAGATTCCATGAGCCCCGTCCTCATCACGGGTGGATGTGGCTTCATTGGCTTTCAC
ATGACGAAGCACATCCTCCAGACTGAAGCCGATTGCAGTATTCACGTCGTGGACATCAACACCACTCACAATACA
CTGCCAGGAGTCGACTACCACAACATTGACATGGCCGATGCCAACAGTCTGCAGACTATTGTCGTCAAAGTCAAG
CCCAGGACCATATTTCACATAGCCAGCCCGGACCCCATGGTTGTGCTGCCCTCGCGGTTCAAAGCGGTCAATGTT
GACGGGACGCGTAACCTCCTCTCAGCATGTGAGGCTGCTGGCACAGTTGGCGCCTTTGTCAACACATCAACGTCG
TCTGTCATTCATGACAACGTCTCTGACTTGGTCAATGCTGGAGAAGAGCTACCCATTGTTCAATACCCTCAGCAA
AAGCGAGCCTACACTCTGACCAAGGCCGTTGCCGAGGGTCTTGTTCTGGCCGCCAATCGGGCTCATGGCGATGGC
TCCATGTTGACTGCCAATCTACGGCCAGCCACCGTCTTTGGCGAGCGTGATTCCATCTGCATGGGAAGGATTGTT
GCCGTTTGCCGGGCAGGCCGGGGTGACATGCAGATTGGCCCGGGTGATAATGAATATGACTTTGTCTACGTTGGC
AACCTGGTTGATGCCCAGATTTTGACGGCCAAGGCCCTGTTACGTGCCTATGGCAAGCCGCCTCCTGCGCCTGAT
ACACGCGTCGATGGCCAATCTTTCAACATCACCAACGACGAACGCATCTTGTTCTGGGACTTTCAGCGGGCAGTA
TCTGCATCAGTTGGACTACCGATTACCAAGGATAAGATCAAAATCGTATCACCGTGGCTTCTCTTATTAATAGCC
TTTATAAGCGAGTGGACGACATGGCTACGTTCCTTTGGCACCAAGCAACCCATGTTTACCAGGGAGGCAGTCTGG
CTAACAACTATAACCCGTACTCTAAATGGCGACAAGGCAAAAAGGGTGCTTGGCTATAAACCGAGGTATAGTATT
AAAGAGGGTTTGGACATTGCTGGCAAGTGGTTCCGTGAGGAAGAGGCCAAGAGGAGTAAGGATAACTAA
Transcript >OphauG2|4449
ATGTCTGCAAGAGATAACCAAGATTCCATGAGCCCCGTCCTCATCACGGGTGGATGTGGCTTCATTGGCTTTCAC
ATGACGAAGCACATCCTCCAGACTGAAGCCGATTGCAGTATTCACGTCGTGGACATCAACACCACTCACAATACA
CTGCCAGGAGTCGACTACCACAACATTGACATGGCCGATGCCAACAGTCTGCAGACTATTGTCGTCAAAGTCAAG
CCCAGGACCATATTTCACATAGCCAGCCCGGACCCCATGGTTGTGCTGCCCTCGCGGTTCAAAGCGGTCAATGTT
GACGGGACGCGTAACCTCCTCTCAGCATGTGAGGCTGCTGGCACAGTTGGCGCCTTTGTCAACACATCAACGTCG
TCTGTCATTCATGACAACGTCTCTGACTTGGTCAATGCTGGAGAAGAGCTACCCATTGTTCAATACCCTCAGCAA
AAGCGAGCCTACACTCTGACCAAGGCCGTTGCCGAGGGTCTTGTTCTGGCCGCCAATCGGGCTCATGGCGATGGC
TCCATGTTGACTGCCAATCTACGGCCAGCCACCGTCTTTGGCGAGCGTGATTCCATCTGCATGGGAAGGATTGTT
GCCGTTTGCCGGGCAGGCCGGGGTGACATGCAGATTGGCCCGGGTGATAATGAATATGACTTTGTCTACGTTGGC
AACCTGGTTGATGCCCAGATTTTGACGGCCAAGGCCCTGTTACGTGCCTATGGCAAGCCGCCTCCTGCGCCTGAT
ACACGCGTCGATGGCCAATCTTTCAACATCACCAACGACGAACGCATCTTGTTCTGGGACTTTCAGCGGGCAGTA
TCTGCATCAGTTGGACTACCGATTACCAAGGATAAGATCAAAATCGTATCACCGTGGCTTCTCTTATTAATAGCC
TTTATAAGCGAGTGGACGACATGGCTACGTTCCTTTGGCACCAAGCAACCCATGTTTACCAGGGAGGCAGTCTGG
CTAACAACTATAACCCGTACTCTAAATGGCGACAAGGCAAAAAGGGTGCTTGGCTATAAACCGAGGTATAGTATT
AAAGAGGGTTTGGACATTGCTGGCAAGTGGTTCCGTGAGGAAGAGGCCAAGAGGAGTAAGGATAACTAA
Gene >OphauG2|4449
ATGTCTGCAAGAGATAACCAAGATTCCATGAGCCCCGTCCTCATCACGGGTGGATGTGGCTTCATTGGCTTTCAC
ATGACGAAGCACATCCTCCAGACTGAAGCCGATTGCAGTATTCACGTCGTGGACATCAACACCACTCACAATACA
CTGCCAGGAGTCGACTACCACAACATTGACATGGCCGATGCCAACAGTCTGCAGACTATTGTCGTCAAAGTCAAG
CCCAGGACCATATTTCACATAGCCAGCCCGGACCCCATGGTTGTGCTGCCCTCGCGGTTCAAAGCGGTCAATGTT
GACGGGACGCGTAACCTCCTCTCAGCATGTGAGGCTGCTGGCACAGTTGGCGCCTTTGTCAACACATCAACGTCG
TCTGTCATTCATGACAACGTCTCTGACTTGGTCAATGCTGGAGAAGAGCTACCCATTGTTCAATACCCTCAGCAA
AAGCGAGCCTACACTCTGACCAAGGCCGTTGCCGAGGGTCTTGTTCTGGCCGCCAATCGGGCTCATGGCGATGGC
TCCATGTTGACTGCCAATCTACGGCCAGCCACCGTCTTTGGCGAGCGTGATTCCATCTGCATGGGAAGGATTGTT
GCCGTTTGCCGGGCAGGCCGGGGTGACATGCAGATTGGCCCGGGTGATAATGAATATGACTTTGTCTACGTTGGC
AACCTGGTTGATGCCCAGATTTTGACGGCCAAGGCCCTGTTACGTGCCTATGGCAAGCCGCCTCCTGCGCCTGAT
ACACGCGTCGATGGCCAATCTTTCAACATCACCAACGACGAACGCATCTTGTTCTGGGACTTTCAGCGGGCAGTA
TCTGCATCAGTTGGACTACCGATTACCAAGGATAAGATCAAAATCGTATCACCGTGGCTTCTCTTATTAATAGCC
TTTATAAGCGAGTGGACGACATGGCTACGTTCCTTTGGCACCAAGCAACCCATGTTTACCAGGGAGGCAGTCTGG
CTAACAACTATAACCCGTACTCTAAATGGCGACAAGGCAAAAAGGGTGCTTGGCTATAAACCGAGGTATAGTATT
AAAGAGGGTTTGGACATTGCTGGCAAGTGGTTCCGTGAGGAAGAGGCCAAGAGGAGTAAGGATAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail