Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4447
Gene name
LocationContig_372:1697..2912
Strand-
Gene length (bp)1215
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 4.1E-07 175 383
PF06500 FrsA-like Esterase FrsA-like 4.2E-08 49 251
PF12146 Hydrolase_4 Serine aminopeptidase, S33 6.3E-07 152 368
PF00326 Peptidase_S9 Prolyl oligopeptidase family 3.7E-07 179 267

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q93NG6|DHPON_ARTNI 2,6-dihydropseudooxynicotine hydrolase OS=Arthrobacter nicotinovorans PE=1 SV=1 1 271 1.0E-14
sp|Q6LTX5|Y837_PHOPR UPF0255 protein PBPRA0837 OS=Photobacterium profundum GN=PBPRA0837 PE=3 SV=1 34 248 2.0E-11
sp|Q7N7B3|Y1242_PHOLL UPF0255 protein plu1242 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=plu1242 PE=3 SV=1 49 271 1.0E-07
sp|Q01609|Y2218_PSEAE Uncharacterized protein PA2218 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA2218 PE=1 SV=2 136 269 5.0E-06

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup705
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4447 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01420
Ophiocordyceps camponoti-rufipedis Ophun1|7078
Ophiocordyceps kimflemingae Ophio5|2059
Ophiocordyceps subramaniannii Hirsu2|136
Ophiocordyceps subramaniannii Hirsu2|5952
Ophiocordyceps subramaniannii Hirsu2|6568
Ophiocordyceps subramaniannii Hirsu2|6569

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4447
MALVRHFFPKDASFGYESLRAAGYANFGGADVAEVITICSRIRPGDQDSWLREWSRAGHRAVANAKTSLAKGNRP
GARDAFLRASNYFRTAEFYRREKPFDDDVSKELASLSASMFYSAADLMSHAIDKTCIPYEGTTLPATLMRPDRSE
NPKPTIIVNGGFDSTREEAGYAVAAAALELGFNVIAFDGPGQGEALREQRLFFRPDWEHVMTPVVDYALAQPWVS
QDKLVIMGVSMGGYLVSRAAAFEHRAAAIIVNDGVYDFGSAFSKENPAIGKLLVKYNWDKTINALVRLLMRWDTG
FRWGISNAKWVFGLSSAAEVLRAVDKYTLEGEVHKIKTPMLVLDAPDDHFLKGQPRILFDRLTCDKEFVEMTKEE
GASAHCHMGSGARLNQVVFDYLLPRLNMS*
Coding >OphauG2|4447
ATGGCCCTGGTGCGACACTTCTTCCCCAAAGACGCGTCCTTTGGCTACGAGAGCCTCCGCGCAGCCGGATACGCC
AACTTTGGCGGCGCAGACGTGGCAGAGGTGATTACCATCTGTTCCCGAATCAGGCCTGGAGACCAGGACAGTTGG
CTACGCGAATGGAGTCGGGCTGGCCATCGAGCAGTCGCCAATGCAAAAACGAGCCTGGCCAAGGGGAACCGTCCT
GGGGCTAGAGATGCCTTTTTACGAGCCTCAAACTACTTCCGAACTGCCGAGTTTTACCGCCGCGAGAAGCCGTTT
GACGATGATGTGTCCAAGGAGCTGGCAAGCCTGAGCGCCAGCATGTTTTATTCTGCGGCAGACCTCATGTCGCAC
GCCATTGACAAGACTTGCATTCCCTACGAGGGGACGACTCTGCCAGCCACTCTCATGCGTCCAGATAGAAGCGAG
AATCCGAAACCAACCATCATCGTCAATGGCGGCTTCGACTCGACGCGAGAGGAGGCTGGCTACGCTGTTGCAGCC
GCTGCTCTGGAGCTGGGCTTCAACGTCATTGCATTTGACGGCCCAGGACAAGGCGAGGCTTTGCGCGAGCAGCGG
CTCTTCTTCCGGCCAGACTGGGAACACGTCATGACGCCCGTCGTCGACTACGCCCTCGCCCAGCCATGGGTGTCG
CAAGACAAACTCGTCATCATGGGCGTCAGCATGGGCGGCTATCTCGTTTCCCGCGCCGCCGCGTTCGAGCACCGC
GCCGCTGCCATCATTGTCAACGACGGCGTCTACGACTTTGGCAGCGCCTTTAGTAAAGAGAACCCAGCCATCGGG
AAGCTCCTCGTCAAGTACAACTGGGACAAGACCATCAACGCCCTTGTCCGGCTGCTGATGCGCTGGGATACTGGC
TTCCGATGGGGCATTTCAAACGCAAAGTGGGTGTTTGGCCTGAGCTCTGCAGCCGAGGTTTTGCGGGCCGTGGAC
AAGTACACGCTTGAGGGAGAGGTGCACAAGATTAAGACGCCAATGCTCGTTCTCGATGCCCCGGATGATCATTTC
CTCAAGGGACAGCCGAGAATCTTGTTTGACAGGCTGACCTGTGACAAGGAGTTTGTCGAGATGACCAAGGAGGAG
GGAGCAAGCGCCCATTGCCACATGGGATCCGGAGCAAGACTGAACCAGGTAGTCTTTGACTATTTGCTGCCGCGC
CTGAATATGTCTTAA
Transcript >OphauG2|4447
ATGGCCCTGGTGCGACACTTCTTCCCCAAAGACGCGTCCTTTGGCTACGAGAGCCTCCGCGCAGCCGGATACGCC
AACTTTGGCGGCGCAGACGTGGCAGAGGTGATTACCATCTGTTCCCGAATCAGGCCTGGAGACCAGGACAGTTGG
CTACGCGAATGGAGTCGGGCTGGCCATCGAGCAGTCGCCAATGCAAAAACGAGCCTGGCCAAGGGGAACCGTCCT
GGGGCTAGAGATGCCTTTTTACGAGCCTCAAACTACTTCCGAACTGCCGAGTTTTACCGCCGCGAGAAGCCGTTT
GACGATGATGTGTCCAAGGAGCTGGCAAGCCTGAGCGCCAGCATGTTTTATTCTGCGGCAGACCTCATGTCGCAC
GCCATTGACAAGACTTGCATTCCCTACGAGGGGACGACTCTGCCAGCCACTCTCATGCGTCCAGATAGAAGCGAG
AATCCGAAACCAACCATCATCGTCAATGGCGGCTTCGACTCGACGCGAGAGGAGGCTGGCTACGCTGTTGCAGCC
GCTGCTCTGGAGCTGGGCTTCAACGTCATTGCATTTGACGGCCCAGGACAAGGCGAGGCTTTGCGCGAGCAGCGG
CTCTTCTTCCGGCCAGACTGGGAACACGTCATGACGCCCGTCGTCGACTACGCCCTCGCCCAGCCATGGGTGTCG
CAAGACAAACTCGTCATCATGGGCGTCAGCATGGGCGGCTATCTCGTTTCCCGCGCCGCCGCGTTCGAGCACCGC
GCCGCTGCCATCATTGTCAACGACGGCGTCTACGACTTTGGCAGCGCCTTTAGTAAAGAGAACCCAGCCATCGGG
AAGCTCCTCGTCAAGTACAACTGGGACAAGACCATCAACGCCCTTGTCCGGCTGCTGATGCGCTGGGATACTGGC
TTCCGATGGGGCATTTCAAACGCAAAGTGGGTGTTTGGCCTGAGCTCTGCAGCCGAGGTTTTGCGGGCCGTGGAC
AAGTACACGCTTGAGGGAGAGGTGCACAAGATTAAGACGCCAATGCTCGTTCTCGATGCCCCGGATGATCATTTC
CTCAAGGGACAGCCGAGAATCTTGTTTGACAGGCTGACCTGTGACAAGGAGTTTGTCGAGATGACCAAGGAGGAG
GGAGCAAGCGCCCATTGCCACATGGGATCCGGAGCAAGACTGAACCAGGTAGTCTTTGACTATTTGCTGCCGCGC
CTGAATATGTCTTAA
Gene >OphauG2|4447
ATGGCCCTGGTGCGACACTTCTTCCCCAAAGACGCGTCCTTTGGCTACGAGAGCCTCCGCGCAGCCGGATACGCC
AACTTTGGCGGCGCAGACGTGGCAGAGGTGATTACCATCTGTTCCCGAATCAGGCCTGGAGACCAGGACAGTTGG
CTACGCGAATGGAGTCGGGCTGGCCATCGAGCAGTCGCCAATGCAAAAACGAGCCTGGCCAAGGGGAACCGTCCT
GGGGCTAGAGATGCCTTTTTACGAGCCTCAAACTACTTCCGAACTGCCGAGTTTTACCGCCGCGAGAAGCCGTTT
GACGATGATGTGTCCAAGGAGCTGGCAAGCCTGAGCGCCAGCATGTTTTATTCTGCGGCAGACCTCATGTCGCAC
GCCATTGACAAGACTTGCATTCCCTACGAGGGGACGACTCTGCCAGCCACTCTCATGCGTCCAGATAGAAGCGAG
AATCCGAAACCAACCATCATCGTCAATGGCGGCTTCGACTCGACGCGAGAGGAGGCTGGCTACGCTGTTGCAGCC
GCTGCTCTGGAGCTGGGCTTCAACGTCATTGCATTTGACGGCCCAGGACAAGGCGAGGCTTTGCGCGAGCAGCGG
CTCTTCTTCCGGCCAGACTGGGAACACGTCATGACGCCCGTCGTCGACTACGCCCTCGCCCAGCCATGGGTGTCG
CAAGACAAACTCGTCATCATGGGCGTCAGCATGGGCGGCTATCTCGTTTCCCGCGCCGCCGCGTTCGAGCACCGC
GCCGCTGCCATCATTGTCAACGACGGCGTCTACGACTTTGGCAGCGCCTTTAGTAAAGAGAACCCAGCCATCGGG
AAGCTCCTCGTCAAGTACAACTGGGACAAGACCATCAACGCCCTTGTCCGGCTGCTGATGCGCTGGGATACTGGC
TTCCGATGGGGCATTTCAAACGCAAAGTGGGTGTTTGGCCTGAGCTCTGCAGCCGAGGTTTTGCGGGCCGTGGAC
AAGTACACGCTTGAGGGAGAGGTGCACAAGATTAAGACGCCAATGCTCGTTCTCGATGCCCCGGATGATCATTTC
CTCAAGGGACAGCCGAGAATCTTGTTTGACAGGCTGACCTGTGACAAGGAGTTTGTCGAGATGACCAAGGAGGAG
GGAGCAAGCGCCCATTGCCACATGGGATCCGGAGCAAGACTGAACCAGGTAGTCTTTGACTATTTGCTGCCGCGC
CTGAATATGTCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail