Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4443
Gene name
LocationContig_371:13600..14414
Strand-
Gene length (bp)814
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01177 Asp_Glu_race Asp/Glu/Hydantoin racemase 4.0E-42 3 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09921|YAKA_SCHPO Uncharacterized protein C1F7.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.10 PE=4 SV=1 1 242 1.0E-23
sp|P32460|DCG1_YEAST Protein DCG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCG1 PE=2 SV=1 2 242 8.0E-17
sp|O74886|YQE2_SCHPO Uncharacterized protein C576.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.02 PE=4 SV=1 3 235 4.0E-08
sp|Q00924|HYUE_PSESN Hydantoin racemase OS=Pseudomonas sp. (strain NS671) GN=hyuE PE=4 SV=1 1 235 4.0E-08

GO

GO Term Description Terminal node
GO:0036361 racemase activity, acting on amino acids and derivatives Yes
GO:0006807 nitrogen compound metabolic process Yes
GO:0016855 racemase and epimerase activity, acting on amino acids and derivatives No
GO:0003674 molecular_function No
GO:0016854 racemase and epimerase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016853 isomerase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6972
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4443 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7559
Ophiocordyceps subramaniannii Hirsu2|2165

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4443
MKLLLINPNSVDAMTKAMQAAAKATPVSDALQIDVYTAPSQAPQSINNGQDIADSTKYVLDDMMDNASVDVQKYD
GLLVACYSAHSLVPRLASGFPRVVVTGIFEASLLTALSLIAGVDSTERWGIVTTGKFWEEHLTDGVGAFLGSQGV
DRRFCGVYSTGLTASDLHSLKPEEIRAKVKSATLKLLAAGNVACVAMGCGAMAGLEDVIRDAAREAYGRQRGDGL
YIVDGVKAGVIQLHQMINCRKIF*
Coding >OphauG2|4443
ATGAAGCTTCTTCTCATCAACCCCAACTCGGTCGATGCCATGACCAAAGCCATGCAAGCCGCAGCAAAAGCGACG
CCCGTGTCAGACGCTCTTCAAATTGATGTATACACTGCCCCGAGCCAAGCACCGCAGAGCATCAACAACGGCCAA
GACATTGCCGATAGCACCAAGTACGTGCTCGATGACATGATGGACAATGCCAGTGTCGATGTGCAAAAGTATGAT
GGCTTGCTTGTGGCATGCTACAGCGCCCATAGTCTTGTCCCACGACTGGCCTCTGGTTTTCCGCGCGTCGTCGTT
ACGGGGATATTCGAGGCCAGCCTTCTCACAGCCCTCTCTCTCATTGCTGGGGTTGACAGCACTGAACGCTGGGGA
ATCGTAACGACTGGTAAGTTCTGGGAAGAGCATCTCACAGATGGCGTCGGGGCGTTTTTGGGCTCCCAAGGAGTG
GACCGCAGGTTCTGCGGCGTTTATTCTACTGGCCTGACGGCTTCAGACCTGCATTCTCTGAAGCCAGAGGAAATT
CGTGCCAAGGTCAAGAGTGCGACGCTAAAGTTACTGGCTGCTGGCAATGTAGCCTGCGTGGCCATGGGATGTGGC
GCCATGGCAGGACTGGAAGACGTGATACGTGACGCTGCTCGCGAGGCATATGGCCGCCAAAGAGGCGATGGGCTC
TACATTGTAGATGGCGTCAAGGCGGGCGTGATTCAACTGCACCAAATGATCAACTGCAGGAAGATATTCTGA
Transcript >OphauG2|4443
ATGAAGCTTCTTCTCATCAACCCCAACTCGGTCGATGCCATGACCAAAGCCATGCAAGCCGCAGCAAAAGCGACG
CCCGTGTCAGACGCTCTTCAAATTGATGTATACACTGCCCCGAGCCAAGCACCGCAGAGCATCAACAACGGCCAA
GACATTGCCGATAGCACCAAGTACGTGCTCGATGACATGATGGACAATGCCAGTGTCGATGTGCAAAAGTATGAT
GGCTTGCTTGTGGCATGCTACAGCGCCCATAGTCTTGTCCCACGACTGGCCTCTGGTTTTCCGCGCGTCGTCGTT
ACGGGGATATTCGAGGCCAGCCTTCTCACAGCCCTCTCTCTCATTGCTGGGGTTGACAGCACTGAACGCTGGGGA
ATCGTAACGACTGGTAAGTTCTGGGAAGAGCATCTCACAGATGGCGTCGGGGCGTTTTTGGGCTCCCAAGGAGTG
GACCGCAGGTTCTGCGGCGTTTATTCTACTGGCCTGACGGCTTCAGACCTGCATTCTCTGAAGCCAGAGGAAATT
CGTGCCAAGGTCAAGAGTGCGACGCTAAAGTTACTGGCTGCTGGCAATGTAGCCTGCGTGGCCATGGGATGTGGC
GCCATGGCAGGACTGGAAGACGTGATACGTGACGCTGCTCGCGAGGCATATGGCCGCCAAAGAGGCGATGGGCTC
TACATTGTAGATGGCGTCAAGGCGGGCGTGATTCAACTGCACCAAATGATCAACTGCAGGAAGATATTCTGA
Gene >OphauG2|4443
ATGAAGCTTCTTCTCATCAACCCCAACTCGGTCGATGCCATGACCAAAGCCATGCAAGCCGCAGCAAAAGCGACG
CCCGTGTCAGACGTATGCTTGACTTCACTTCCTGTCAATGGACAGACCATGCCACTGCCGCTCGGCTGACGCGTC
CGAGGCTCTTCAAATTGATGTATACACTGCCCCGAGCCAAGCACCGCAGAGCATCAACAACGGCCAAGACATTGC
CGATAGCACCAAGTACGTGCTCGATGACATGATGGACAATGCCAGTGTCGATGTGCAAAAGTATGATGGCTTGCT
TGTGGCATGCTACAGCGCCCATAGTCTTGTCCCACGACTGGCCTCTGGTTTTCCGCGCGTCGTCGTTACGGGGAT
ATTCGAGGCCAGCCTTCTCACAGCCCTCTCTCTCATTGCTGGGGTTGACAGCACTGAACGCTGGGGAATCGTAAC
GACTGGTAAGTTCTGGGAAGAGCATCTCACAGATGGCGTCGGGGCGTTTTTGGGCTCCCAAGGAGTGGACCGCAG
GTTCTGCGGCGTTTATTCTACTGGCCTGACGGCTTCAGACCTGCATTCTCTGAAGCCAGAGGAAATTCGTGCCAA
GGTCAAGAGTGCGACGCTAAAGTTACTGGCTGCTGGCAATGTAGCCTGCGTGGCCATGGGATGTGGCGCCATGGC
AGGACTGGAAGACGTGATACGTGACGCTGCTCGCGAGGCATATGGCCGCCAAAGAGGCGATGGGCTCTACATTGT
AGATGGCGTCAAGGCGGGCGTGATTCAACTGCACCAAATGATCAACTGCAGGAAGATATTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail