Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4431
Gene name
LocationContig_37:44086..47412
Strand-
Gene length (bp)3326
Transcript length (bp)2943
Coding sequence length (bp)2943
Protein length (aa) 981

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 5.3E-07 272 343
PF00013 KH_1 KH domain 1.6E-06 562 606

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74359|MUG60_SCHPO Meiotically up-regulated gene 60 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug60 PE=1 SV=1 234 633 5.0E-21
sp|Q07834|YL032_YEAST KH domain-containing protein YLL032C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL032C PE=1 SV=1 266 709 1.0E-20
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 238 713 3.0E-07
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 238 713 1.0E-06
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 238 793 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74359|MUG60_SCHPO Meiotically up-regulated gene 60 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug60 PE=1 SV=1 234 633 5.0E-21
sp|Q07834|YL032_YEAST KH domain-containing protein YLL032C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLL032C PE=1 SV=1 266 709 1.0E-20
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 238 713 3.0E-07
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 238 713 1.0E-06
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 238 793 2.0E-06
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 238 713 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4431
MNKLANMRHWSERMSPNFGMGRPASNMPMNAPNPHPPPKNASQPSGATSLPQPSDTTIHHSFNVPFALDLAGPNT
EDIVHATTDAVIRWTHPEDAPDDVQVHELPAHAQNLASLNKLCTDLSLGPLPIEAHVLSSFPQNNKGYRVVTVCL
SGSPELVNKSRETILNEIPISMRCITIDIDGNLVCDLRAGVLKKHVVENLDFISSFCGVDIFLLGPKLTPMVGGL
TGDSEMRIDQRWRVTIYGDILSSEHAKARVLVHIDTLLGRVVDSTKLDSTLHQLVCGRHRKNIKLIESSTGTAIY
FPPIFSQMYRYCPPKAHRRDPCEIFITGPTRQTIDLAKQKLREFASRVRIFVKDVTIPASKVDSILLSRLEKVRK
ILEANGTYVILPSLASQRTLIRVQGSEAFSVERTVRELMCLAGQFYGAGWYTQQVDQRHLQAPADIRGMLGEICA
NSDADLSFDRLNFTVTGSDDAVKSALSVISGLRFATQAPYQIRVKIELANEHKEFVSGKKNGKINKIMGQSNVQI
IFDGFNEYNFNIDVMAASYESMKQGLALVEQEMPASISFHVPDQYHKRIIGIGGQHIQRIMKKHSVFVKFSNAMD
RGGMSREDDDVKVDNVICRTPARNAQNLDAVKNEILEMVDRADSEYTTQVVSVDRLYHRELIARLPDIDDLEQKY
NCKITFPSTEEASDEVTVTGPQWQVPHCVDEFLGMVPDKHELVLGRSTELVSFLDSPNFATDLVIKLRTQYEVEV
TVHRNPDELTVEGSPTVTLVWGFTRNNAGGLRDAIDFLQAQLAAAGVEPNIIKGSIPRPKSDSFEDSLQYFDSKL
LQHAPASFATESPIKEILGAEVAHERSSILDRLRKPGSMTSISSFLDRRKNSSHSTAGNFFKGSSNVSKSSLISI
ESTRSFNADRNPWNDSGVNLADDDHPWAPRLMGKTTDKLTIPHPGDVTPRHGTRASGDSGRPSTSHSMNSGYPGP
AGPFR*
Coding >OphauG2|4431
ATGAACAAGTTGGCAAATATGCGTCACTGGTCCGAGAGGATGAGCCCCAACTTTGGCATGGGACGTCCTGCTTCA
AACATGCCCATGAACGCACCCAATCCTCATCCTCCGCCCAAGAACGCGTCGCAGCCTTCGGGTGCCACCAGTCTG
CCGCAGCCCTCGGATACCACCATTCATCACTCCTTCAATGTACCTTTCGCTCTCGATCTAGCCGGTCCAAACACT
GAAGACATCGTCCACGCCACAACCGACGCTGTCATCCGCTGGACGCATCCCGAAGACGCACCCGATGACGTCCAA
GTGCATGAATTGCCCGCCCACGCTCAAAACCTGGCTAGCCTCAACAAACTTTGCACTGACTTGTCCCTCGGCCCA
CTTCCAATCGAGGCGCACGTCTTATCTTCGTTTCCTCAGAACAACAAGGGCTATCGTGTTGTCACAGTCTGTTTA
TCTGGCTCACCCGAGCTCGTCAACAAGAGTCGTGAGACCATCTTGAATGAGATACCCATTTCAATGCGCTGCATC
ACTATAGATATCGATGGTAACCTCGTCTGCGACCTTCGCGCTGGTGTTCTCAAGAAGCATGTTGTCGAAAACCTT
GATTTCATTTCGAGCTTTTGCGGTGTTGATATATTTCTACTTGGGCCCAAGTTGACACCCATGGTTGGGGGGCTC
ACGGGAGATTCGGAAATGCGCATTGATCAAAGATGGAGAGTGACCATTTATGGTGATATATTATCGTCGGAGCAT
GCCAAAGCCCGTGTCTTGGTGCACATCGATACACTGCTTGGCCGTGTTGTCGACTCGACAAAGCTCGACTCAACT
CTGCACCAGCTGGTCTGCGGTCGACACCGCAAAAACATCAAACTGATTGAATCATCTACGGGTACTGCTATTTAC
TTCCCCCCCATATTCTCCCAAATGTATCGTTACTGTCCACCGAAAGCCCATCGCCGTGACCCCTGCGAGATATTC
ATCACCGGCCCGACTCGTCAAACCATCGATCTGGCCAAACAGAAGCTCCGTGAATTCGCCTCGCGTGTACGCATC
TTTGTTAAAGACGTCACCATTCCTGCTTCCAAGGTCGATAGCATCCTGCTGAGCCGGTTGGAAAAAGTGCGCAAA
ATCCTCGAGGCCAACGGGACATATGTTATATTGCCCTCACTGGCCAGCCAGCGCACATTGATTCGTGTACAGGGC
AGCGAGGCTTTTTCGGTTGAGCGCACAGTGCGTGAGCTCATGTGTCTAGCCGGTCAATTTTACGGTGCCGGATGG
TACACTCAGCAGGTCGATCAAAGACACCTCCAGGCGCCGGCCGACATTAGAGGCATGCTTGGCGAAATTTGTGCC
AACTCGGATGCCGACTTGTCATTTGACAGGCTCAACTTCACAGTGACTGGCTCTGATGACGCTGTCAAGTCGGCG
CTGTCGGTAATCTCTGGACTTCGATTTGCAACCCAGGCTCCCTATCAGATTCGCGTAAAAATCGAACTCGCCAAT
GAACACAAGGAGTTTGTCAGTGGAAAGAAGAACGGGAAAATCAACAAGATTATGGGTCAAAGCAATGTACAGATT
ATATTCGACGGTTTCAACGAGTACAACTTCAACATCGATGTCATGGCTGCAAGTTATGAATCCATGAAGCAAGGC
CTGGCTCTAGTGGAGCAGGAGATGCCTGCGTCGATTTCGTTTCACGTTCCAGACCAGTATCACAAGCGCATCATT
GGCATTGGTGGCCAACATATTCAGCGCATCATGAAGAAACACTCAGTCTTTGTAAAGTTCTCCAATGCTATGGAC
AGAGGGGGAATGAGCCGCGAAGATGATGATGTCAAAGTGGACAATGTCATATGCCGCACGCCTGCTCGCAACGCG
CAGAATTTGGACGCGGTCAAGAACGAAATATTGGAAATGGTTGATCGAGCTGATTCGGAGTATACAACTCAGGTG
GTCAGTGTCGACCGTCTTTACCATCGCGAACTCATTGCTCGTCTGCCCGACATCGACGACTTGGAGCAAAAATAC
AACTGCAAAATTACGTTTCCCAGCACCGAAGAGGCAAGCGACGAGGTGACTGTCACGGGCCCCCAGTGGCAGGTG
CCTCATTGCGTCGACGAATTCCTGGGCATGGTGCCTGACAAACACGAGTTGGTGCTCGGTCGAAGCACTGAACTT
GTCAGCTTTCTTGATTCGCCCAATTTCGCCACAGATCTCGTGATCAAACTAAGAACGCAGTACGAGGTCGAGGTG
ACAGTTCACCGCAACCCGGACGAGCTTACTGTCGAGGGAAGCCCAACAGTCACGTTGGTCTGGGGCTTCACTCGC
AACAATGCAGGCGGACTGCGAGATGCCATTGATTTTCTCCAAGCGCAATTGGCGGCGGCTGGCGTCGAGCCCAAT
ATCATCAAGGGCTCTATACCTCGCCCAAAGTCTGACTCGTTTGAAGACTCTCTGCAGTACTTTGACTCAAAGCTA
TTGCAGCACGCTCCCGCCTCTTTTGCCACCGAGTCTCCCATCAAGGAGATTTTGGGAGCAGAGGTGGCACACGAA
CGCAGCAGCATTCTTGACCGCTTGCGCAAACCTGGCAGCATGACATCTATCTCATCGTTCCTCGATCGTCGTAAG
AACAGCTCGCATTCGACGGCTGGGAATTTCTTCAAGGGCTCAAGCAATGTGTCCAAGTCTTCGCTCATCTCGATA
GAGTCGACACGTAGCTTCAATGCTGATCGCAATCCCTGGAACGACAGCGGCGTTAATCTCGCCGATGATGACCAC
CCGTGGGCTCCGCGTCTCATGGGGAAAACCACGGACAAATTGACTATTCCACATCCTGGTGATGTTACACCACGC
CATGGCACTCGAGCTTCGGGTGACAGCGGCCGTCCCTCTACTTCTCACTCAATGAATTCTGGATACCCTGGTCCT
GCTGGGCCCTTCCGTTAA
Transcript >OphauG2|4431
ATGAACAAGTTGGCAAATATGCGTCACTGGTCCGAGAGGATGAGCCCCAACTTTGGCATGGGACGTCCTGCTTCA
AACATGCCCATGAACGCACCCAATCCTCATCCTCCGCCCAAGAACGCGTCGCAGCCTTCGGGTGCCACCAGTCTG
CCGCAGCCCTCGGATACCACCATTCATCACTCCTTCAATGTACCTTTCGCTCTCGATCTAGCCGGTCCAAACACT
GAAGACATCGTCCACGCCACAACCGACGCTGTCATCCGCTGGACGCATCCCGAAGACGCACCCGATGACGTCCAA
GTGCATGAATTGCCCGCCCACGCTCAAAACCTGGCTAGCCTCAACAAACTTTGCACTGACTTGTCCCTCGGCCCA
CTTCCAATCGAGGCGCACGTCTTATCTTCGTTTCCTCAGAACAACAAGGGCTATCGTGTTGTCACAGTCTGTTTA
TCTGGCTCACCCGAGCTCGTCAACAAGAGTCGTGAGACCATCTTGAATGAGATACCCATTTCAATGCGCTGCATC
ACTATAGATATCGATGGTAACCTCGTCTGCGACCTTCGCGCTGGTGTTCTCAAGAAGCATGTTGTCGAAAACCTT
GATTTCATTTCGAGCTTTTGCGGTGTTGATATATTTCTACTTGGGCCCAAGTTGACACCCATGGTTGGGGGGCTC
ACGGGAGATTCGGAAATGCGCATTGATCAAAGATGGAGAGTGACCATTTATGGTGATATATTATCGTCGGAGCAT
GCCAAAGCCCGTGTCTTGGTGCACATCGATACACTGCTTGGCCGTGTTGTCGACTCGACAAAGCTCGACTCAACT
CTGCACCAGCTGGTCTGCGGTCGACACCGCAAAAACATCAAACTGATTGAATCATCTACGGGTACTGCTATTTAC
TTCCCCCCCATATTCTCCCAAATGTATCGTTACTGTCCACCGAAAGCCCATCGCCGTGACCCCTGCGAGATATTC
ATCACCGGCCCGACTCGTCAAACCATCGATCTGGCCAAACAGAAGCTCCGTGAATTCGCCTCGCGTGTACGCATC
TTTGTTAAAGACGTCACCATTCCTGCTTCCAAGGTCGATAGCATCCTGCTGAGCCGGTTGGAAAAAGTGCGCAAA
ATCCTCGAGGCCAACGGGACATATGTTATATTGCCCTCACTGGCCAGCCAGCGCACATTGATTCGTGTACAGGGC
AGCGAGGCTTTTTCGGTTGAGCGCACAGTGCGTGAGCTCATGTGTCTAGCCGGTCAATTTTACGGTGCCGGATGG
TACACTCAGCAGGTCGATCAAAGACACCTCCAGGCGCCGGCCGACATTAGAGGCATGCTTGGCGAAATTTGTGCC
AACTCGGATGCCGACTTGTCATTTGACAGGCTCAACTTCACAGTGACTGGCTCTGATGACGCTGTCAAGTCGGCG
CTGTCGGTAATCTCTGGACTTCGATTTGCAACCCAGGCTCCCTATCAGATTCGCGTAAAAATCGAACTCGCCAAT
GAACACAAGGAGTTTGTCAGTGGAAAGAAGAACGGGAAAATCAACAAGATTATGGGTCAAAGCAATGTACAGATT
ATATTCGACGGTTTCAACGAGTACAACTTCAACATCGATGTCATGGCTGCAAGTTATGAATCCATGAAGCAAGGC
CTGGCTCTAGTGGAGCAGGAGATGCCTGCGTCGATTTCGTTTCACGTTCCAGACCAGTATCACAAGCGCATCATT
GGCATTGGTGGCCAACATATTCAGCGCATCATGAAGAAACACTCAGTCTTTGTAAAGTTCTCCAATGCTATGGAC
AGAGGGGGAATGAGCCGCGAAGATGATGATGTCAAAGTGGACAATGTCATATGCCGCACGCCTGCTCGCAACGCG
CAGAATTTGGACGCGGTCAAGAACGAAATATTGGAAATGGTTGATCGAGCTGATTCGGAGTATACAACTCAGGTG
GTCAGTGTCGACCGTCTTTACCATCGCGAACTCATTGCTCGTCTGCCCGACATCGACGACTTGGAGCAAAAATAC
AACTGCAAAATTACGTTTCCCAGCACCGAAGAGGCAAGCGACGAGGTGACTGTCACGGGCCCCCAGTGGCAGGTG
CCTCATTGCGTCGACGAATTCCTGGGCATGGTGCCTGACAAACACGAGTTGGTGCTCGGTCGAAGCACTGAACTT
GTCAGCTTTCTTGATTCGCCCAATTTCGCCACAGATCTCGTGATCAAACTAAGAACGCAGTACGAGGTCGAGGTG
ACAGTTCACCGCAACCCGGACGAGCTTACTGTCGAGGGAAGCCCAACAGTCACGTTGGTCTGGGGCTTCACTCGC
AACAATGCAGGCGGACTGCGAGATGCCATTGATTTTCTCCAAGCGCAATTGGCGGCGGCTGGCGTCGAGCCCAAT
ATCATCAAGGGCTCTATACCTCGCCCAAAGTCTGACTCGTTTGAAGACTCTCTGCAGTACTTTGACTCAAAGCTA
TTGCAGCACGCTCCCGCCTCTTTTGCCACCGAGTCTCCCATCAAGGAGATTTTGGGAGCAGAGGTGGCACACGAA
CGCAGCAGCATTCTTGACCGCTTGCGCAAACCTGGCAGCATGACATCTATCTCATCGTTCCTCGATCGTCGTAAG
AACAGCTCGCATTCGACGGCTGGGAATTTCTTCAAGGGCTCAAGCAATGTGTCCAAGTCTTCGCTCATCTCGATA
GAGTCGACACGTAGCTTCAATGCTGATCGCAATCCCTGGAACGACAGCGGCGTTAATCTCGCCGATGATGACCAC
CCGTGGGCTCCGCGTCTCATGGGGAAAACCACGGACAAATTGACTATTCCACATCCTGGTGATGTTACACCACGC
CATGGCACTCGAGCTTCGGGTGACAGCGGCCGTCCCTCTACTTCTCACTCAATGAATTCTGGATACCCTGGTCCT
GCTGGGCCCTTCCGTTAA
Gene >OphauG2|4431
ATGAACAAGTTGGCAAATATGCGTCACTGGTCCGAGAGGATGAGCCCCAACTTTGGCATGGGACGTCCTGCTTCA
AACATGCCCATGAACGCACCCAATCCTCATCCTCCGCCCAAGAACGCGTCGCAGCCTTCGGGTGCCACCAGTCTG
CCGCAGCCCTCGGATACCACCATTCATCACTCCTTCAATGTACCTTTCGCTCTCGATCTAGCCGGTCCAAACACT
GAAGACATCGTCCACGCCACAACCGACGCTGTCATCCGCTGGACGCATCCCGAAGACGCACCCGATGACGTCCAA
GTGCATGAATTGCCCGCCCACGCTCAAAACCTGGCTAGCCTCAACAAACTTTGCACTGACTTGTCCCTCGGCCCA
CTTCCAATCGAGGCGCACGTCTTATCTTCGTTTCCTCAGAACAACAAGGGCTATCGTGTTGTCACAGTCTGTTTA
TCTGGCTCACCCGAGCTCGTCAACAAGAGTCGTGAGACCATCTTGAATGAGATACCCATTTCAATGGTATGCTCC
TCATTTATTCCAGTGTCCTGAACAATCTCACCCATACCATGATTTTCGTTGACTCGAATTGCAGCGCTGCATCAC
TATAGATATCGATGGTAACCTCGTCTGCGACCTTCGCGCTGGTGTTCTCAAGAAGCATGTTGTCGAAAACCTTGA
TTTCATTTCGAGCTTTTGCGGTGTTGATATATTTCTACTTGGGCCCAAGTTGACACCCATGGTTGGGGGGCTCAC
GGGAGATTCGGAAATGCGCATTGATCAAAGATGGAGAGTGACCATTTATGGTGATATATTATCGTCGGAGCATGC
CAAAGCCCGTGTCTTGGTGCACATCGATACACTGGTATTCTACCCATCCAAACTCGGCCCTCTCCCTGGTAGTGA
CTAACTGCTTCTCAGCTTGGCCGTGTTGTCGACTCGACAAAGCTCGACTCAACTCTGCACCAGCTGGTCTGCGGT
CGACACCGCAAAAACATCAAACTGATTGAATCATCTACGGGTACTGCTATTTACTTCCCCCCCATATTCTCCCAA
ATGTATCGTTACTGTCCACCGAAAGCCCATCGCCGTGACCCCTGCGAGATATTCATCACCGGCCCGACTCGTCAA
ACCATCGATCTGGCCAAACAGAAGCTCCGTGAATTCGCCTCGCGTGTACGCATCTTTGTTAAAGACGTCACCATT
CCTGCTTCCAAGGTCGATAGCATCCTGCTGAGCCGGTTGGAAAAAGTGCGCAAAATCCTCGAGGCCAACGGGACA
TATGTTATATTGCCCTCACTGGCCAGCCAGCGCACATTGATTCGTGTACAGGGCAGCGAGGCTTTTTCGGTTGAG
CGCACAGTGCGTGAGCTCATGTGTCTAGTAAGCGACTGACTATTTGCACATTAGTACAAACAGTCTCTGACCCCG
TCATAGGCCGGTCAATTTTACGGTGCCGGATGGTACACTCAGCAGGTCGATCAAAGACACCTCCAGGCGCCGGCC
GACATTAGAGGCATGCTTGGCGAAATTTGTGCCAACTCGGATGCCGACTTGTCATTTGACAGGCTCAACTTCACA
GTGACTGGCTCTGATGACGCTGTCAAGTCGGCGCTGTCGGTAATCTCTGGACTTCGATTTGCAACCCAGGCTCCC
TATCAGATTCGCGTAAAAATCGAACTCGCCAATGAACACAAGGAGTTTGTCAGTGGAAAGAAGAACGGGAAAATC
AACAAGATTATGGGTCAAAGTAAGTTCCACCCAAGACTTCGGCGTATCGATGGCTTGGGTAGCAATGTTAAGCAA
CTTGTGTTTCCCTATTGTGCGCAGGCAATGTACAGATTATATTCGACGGTTTCAACGAGTACAACTTCAACATCG
ATGTCATGGCTGCAAGTTATGAATCCATGAAGCAAGGCCTGGCTCTAGTGGAGCAGGAGATGCCTGCGTCGATTT
CGTTTCACGTTCCAGACCAGTATCACAAGCGCATCATTGGCATTGGTGGCCAACATATTCAGCGCATCATGAAGA
AACACTCAGTCTTTGTAAAGTTCTCCAATGCTATGGACAGAGGTGAGACGAGCCGATTCTTGTTTCCACTACTTC
TGCCAACTCATGAGCCTACAGGGGGAATGAGCCGCGAAGATGATGATGTCAAAGTGGACAATGTCATATGCCGCA
CGCCTGCTCGCAACGCGCAGAATTTGGACGCGGTCAAGAACGAAATATTGGAAATGGTTGATCGAGCTGTATGTG
AAGCGTGTTGTGTGCGTCGTGTTATCACAGTGGAACTCGCTCACGATTGTGACGCATAGGATTCGGAGTATACAA
CTCAGGTGGTCAGTGTCGACCGTCTTTACCATCGCGAACTCATTGCTCGTCTGCCCGACATCGACGACTTGGAGC
AAAAATACAACTGCAAAATTACGTTTCCCAGCACCGAAGAGGCAAGCGACGAGGTGACTGTCACGGGCCCCCAGT
GGCAGGTGCCTCATTGCGTCGACGAATTCCTGGGCATGGTGCCTGACAAACACGAGTTGGTGCTCGGTCGAAGCA
CTGAACTTGTCAGCTTTCTTGATTCGCCCAATTTCGCCACAGATCTCGTGATCAAACTAAGAACGCAGTACGAGG
TCGAGGTGACAGTTCACCGCAACCCGGACGAGCTTACTGTCGAGGGAAGCCCAACAGTCACGTTGGTCTGGGGCT
TCACTCGCAACAATGCAGGCGGACTGCGAGATGCCATTGATTTTCTCCAAGCGCAATTGGCGGCGGCTGGCGTCG
AGCCCAATATCATCAAGGGCTCTATACCTCGCCCAAAGTCTGACTCGTTTGAAGACTCTCTGCAGTACTTTGACT
CAAAGCTATTGCAGCACGCTCCCGCCTCTTTTGCCACCGAGTCTCCCATCAAGGAGATTTTGGGAGCAGAGGTGG
CACACGAACGCAGCAGCATTCTTGACCGCTTGCGCAAACCTGGCAGCATGACATCTATCTCATCGTTCCTCGATC
GTCGTAAGAACAGCTCGCATTCGACGGCTGGGAATTTCTTCAAGGGCTCAAGCAATGTGTCCAAGTCTTCGCTCA
TCTCGATAGAGTCGACACGTAGCTTCAATGCTGATCGCAATCCCTGGAACGACAGCGGCGTTAATCTCGCCGATG
ATGACCACCCGTGGGCTCCGCGTCTCATGGGGAAAACCACGGACAAATTGACTATTCCACATCCTGGTGATGTTA
CACCACGCCATGGCACTCGAGCTTCGGGTGACAGCGGCCGTCCCTCTACTTCTCACTCAATGAATTCTGGATACC
CTGGTCCTGCTGGGCCCTTCCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail