Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4430
Gene name
LocationContig_37:40480..42515
Strand+
Gene length (bp)2035
Transcript length (bp)1887
Coding sequence length (bp)1887
Protein length (aa) 629

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04851 ResIII Type III restriction enzyme, res subunit 7.7E-23 19 181
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-13 260 358
PF00270 DEAD DEAD/DEAH box helicase 5.3E-08 23 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 19 594 2.0E-113
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 21 387 3.0E-103
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 19 373 3.0E-26
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 50 371 4.0E-17
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 3 376 7.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR1|IRC3_SCHPO Putative mitochondrial ATP-dependent helicase irc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=irc3 PE=3 SV=2 19 594 2.0E-113
sp|Q06683|IRC3_YEAST Putative ATP-dependent helicase IRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC3 PE=1 SV=1 21 387 3.0E-103
sp|P33919|YEJH_ECOLI Uncharacterized protein YejH OS=Escherichia coli (strain K12) GN=yejH PE=3 SV=2 19 373 3.0E-26
sp|P24125|V51K_BPL79 51.5 kDa protein OS=Lactococcus phage (isolate 7-9) PE=3 SV=1 50 371 4.0E-17
sp|P08956|T1RK_ECOLI Type I restriction enzyme EcoKI R protein OS=Escherichia coli (strain K12) GN=hsdR PE=3 SV=3 3 376 7.0E-15
sp|Q07736|T1RA_ECOLX Type I restriction enzyme EcoAI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 22 375 4.0E-12
sp|Q914K8|Y022_SIFVH Putative helicase 22 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0022 PE=3 SV=1 21 371 4.0E-12
sp|Q47281|T1RE_ECOLX Type I restriction enzyme EcoEI R protein OS=Escherichia coli GN=hsdR PE=3 SV=1 22 426 5.0E-12
sp|P38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III OS=Homo sapiens GN=EIF4A3 PE=1 SV=4 268 357 1.0E-07
sp|B5FZY7|IF4A3_TAEGU Eukaryotic initiation factor 4A-III OS=Taeniopygia guttata GN=EIF4A3 PE=2 SV=1 268 357 1.0E-07
sp|Q5ZM36|IF4A3_CHICK Eukaryotic initiation factor 4A-III OS=Gallus gallus GN=EIF4A3 PE=2 SV=1 268 357 1.0E-07
sp|Q4R3Q1|IF4A3_MACFA Eukaryotic initiation factor 4A-III OS=Macaca fascicularis GN=EIF4A3 PE=2 SV=3 268 357 1.0E-07
sp|Q2NL22|IF4A3_BOVIN Eukaryotic initiation factor 4A-III OS=Bos taurus GN=EIF4A3 PE=2 SV=3 268 357 1.0E-07
sp|A6M931|IF4A3_PIG Eukaryotic initiation factor 4A-III OS=Sus scrofa GN=EIF4A3 PE=2 SV=1 268 357 1.0E-07
sp|Q3B8Q2|IF4A3_RAT Eukaryotic initiation factor 4A-III OS=Rattus norvegicus GN=Eif4a3 PE=1 SV=1 268 357 1.0E-07
sp|Q91VC3|IF4A3_MOUSE Eukaryotic initiation factor 4A-III OS=Mus musculus GN=Eif4a3 PE=1 SV=3 268 357 1.0E-07
sp|B5DG42|IF4A3_SALSA Eukaryotic initiation factor 4A-III OS=Salmo salar GN=eif4a3 PE=2 SV=1 268 357 2.0E-07
sp|O42226|I4A3B_XENLA Eukaryotic initiation factor 4A-III-B OS=Xenopus laevis GN=eif4a3-b PE=2 SV=1 268 357 2.0E-07
sp|B7ZTW1|IF4A3_XENTR Eukaryotic initiation factor 4A-III OS=Xenopus tropicalis GN=eif4a3 PE=2 SV=1 268 357 2.0E-07
sp|Q5U526|I4A3A_XENLA Eukaryotic initiation factor 4A-III-A OS=Xenopus laevis GN=eif4a3-a PE=2 SV=1 268 362 2.0E-07
sp|Q9VHS8|IF4A3_DROME Eukaryotic initiation factor 4A-III OS=Drosophila melanogaster GN=eIF4AIII PE=1 SV=1 268 358 9.0E-07
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 267 357 1.0E-06
sp|Q5V5F7|RAD25_HALMA Putative DNA helicase Rad25 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rad25 PE=3 SV=2 18 357 1.0E-06
sp|Q7ZVA6|IF4A3_DANRE Eukaryotic initiation factor 4A-III OS=Danio rerio GN=eif4a3 PE=2 SV=1 268 357 2.0E-06
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 23 397 9.0E-06
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 23 397 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0016787 hydrolase activity Yes
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0032555 purine ribonucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2520
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4430 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1165
Ophiocordyceps camponoti-floridani Ophcf2|04156
Ophiocordyceps camponoti-rufipedis Ophun1|2157
Ophiocordyceps kimflemingae Ophio5|3013
Ophiocordyceps subramaniannii Hirsu2|3685

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4430
MRPTSQSQLSRASTLATKLTLRDYQLECIRSVIASLGRGHKRVGISLATGSGKTVIFTQLIDQVGPRFDGKGDRT
LILAHRCELVEQAARQCQLAYPDKTIDIEMGSLHASGTADITVASVRSITSRDRLAKYDPAAFKLVLVDEAHHIV
ASSYLRTLKHFGLDQKQAESPTLVGVSATFSRFDGLKLGTAIDEIVYHKDYIDMIEDKWLADVMLTTVESKANLS
KVRSNASGDFQTGDLSNVVNTEEVNEIAVRSWIAKASDRKSTLVFCVDLAHVAGLTQKFREYGFDARSVTGDTPK
LQRSCTLDAFKAGHYPILVNCGVFTEGTDIPNIDCIVISRPTRSRNLLVQMIGRGMRLHPGKQNCHIIDIVSSLE
TGIITTPTLFGLDPNLLVDKVSVTKIKDQKFQDSPDQQQASRTDSTIASNSPIIFTEYSSVLDLIADTSGEKHIR
AISQNAWIQSAPDSYVLSAPSGSYIRLERIQEEAITKPTAWYRAVEVRALPPGLCKSPFAARREILTAATFEDAV
HGADRYAADAFPYTFINRHQPWRSLPATQGQLNFINKIRGKAEPLIAAELTKGRAADMITKIKHGARGQFNKIEA
EQRRRLRQASMMDARRNREVVRVGPVAA*
Coding >OphauG2|4430
ATGCGCCCAACCTCACAATCACAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAG
CTCGAATGCATCCGCTCTGTCATTGCATCGCTCGGGCGAGGCCATAAGCGAGTTGGAATCTCTTTGGCTACCGGT
AGCGGCAAAACAGTCATCTTCACTCAGCTCATCGACCAAGTCGGCCCGCGATTCGACGGCAAAGGAGACCGCACT
CTCATCTTGGCCCATCGCTGCGAATTGGTAGAGCAAGCTGCTCGCCAATGCCAGCTGGCGTATCCAGACAAGACA
ATCGACATCGAAATGGGCTCTCTTCACGCCTCAGGCACAGCCGACATCACGGTAGCCAGTGTTCGAAGCATCACG
TCGAGGGATCGTCTTGCCAAGTACGACCCTGCTGCCTTCAAGCTTGTCCTTGTCGACGAAGCCCACCACATTGTC
GCTTCAAGCTACCTACGCACTCTCAAGCACTTTGGTCTCGACCAGAAGCAAGCAGAGTCGCCCACGCTTGTTGGC
GTGTCGGCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCACTGCTATTGACGAGATTGTCTACCACAAGGAC
TATATCGACATGATCGAGGACAAGTGGCTGGCGGATGTCATGCTGACTACGGTTGAATCCAAGGCAAACCTGTCA
AAGGTTCGCAGCAATGCTAGTGGCGACTTCCAAACCGGAGACCTGTCAAACGTGGTCAACACGGAAGAGGTCAAT
GAAATCGCTGTTCGCAGCTGGATAGCCAAGGCCTCTGACCGTAAATCAACTCTGGTATTCTGCGTCGACCTCGCC
CATGTTGCTGGCTTGACCCAAAAGTTTCGTGAATATGGCTTCGACGCAAGGTCTGTTACAGGAGACACGCCCAAG
CTACAACGAAGCTGCACTCTAGACGCTTTCAAAGCCGGCCATTATCCTATCCTTGTTAACTGCGGCGTCTTTACT
GAGGGCACCGACATCCCAAATATTGACTGCATCGTCATTAGCCGCCCGACTAGATCACGCAACTTGCTCGTACAA
ATGATAGGTCGAGGCATGCGCCTCCATCCAGGCAAACAGAACTGCCACATTATTGATATCGTCTCAAGTCTAGAG
ACGGGCATCATCACGACACCTACCCTCTTCGGCCTCGATCCAAATTTGCTGGTGGACAAAGTGTCCGTCACGAAA
ATCAAGGATCAAAAATTTCAGGACAGCCCTGATCAACAGCAAGCAAGTAGAACAGATTCAACAATTGCCTCAAAC
AGCCCTATAATCTTCACCGAGTACTCATCCGTACTTGATCTCATTGCCGATACATCGGGCGAGAAACACATTCGT
GCCATCAGCCAGAATGCCTGGATCCAGTCCGCTCCCGATAGCTATGTCCTTTCGGCCCCAAGCGGCTCTTACATT
CGACTCGAGCGTATTCAAGAAGAAGCCATCACCAAGCCAACCGCTTGGTATCGCGCCGTAGAGGTGCGCGCTCTT
CCTCCCGGCTTGTGCAAGTCGCCATTTGCCGCACGCAGAGAGATTCTTACTGCGGCCACTTTTGAAGACGCTGTT
CACGGCGCAGACCGTTATGCAGCAGACGCCTTTCCCTACACTTTCATCAATCGACACCAGCCTTGGCGCTCGCTC
CCAGCAACTCAGGGTCAACTCAACTTCATCAACAAGATACGTGGCAAGGCTGAGCCCTTAATAGCAGCCGAGTTG
ACAAAGGGAAGAGCAGCAGATATGATTACTAAAATCAAGCATGGAGCCCGCGGCCAATTCAACAAAATCGAAGCT
GAGCAGCGAAGACGCCTCAGACAAGCTTCCATGATGGATGCTAGACGAAACCGCGAAGTCGTTAGGGTCGGGCCT
GTGGCAGCTTGA
Transcript >OphauG2|4430
ATGCGCCCAACCTCACAATCACAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAG
CTCGAATGCATCCGCTCTGTCATTGCATCGCTCGGGCGAGGCCATAAGCGAGTTGGAATCTCTTTGGCTACCGGT
AGCGGCAAAACAGTCATCTTCACTCAGCTCATCGACCAAGTCGGCCCGCGATTCGACGGCAAAGGAGACCGCACT
CTCATCTTGGCCCATCGCTGCGAATTGGTAGAGCAAGCTGCTCGCCAATGCCAGCTGGCGTATCCAGACAAGACA
ATCGACATCGAAATGGGCTCTCTTCACGCCTCAGGCACAGCCGACATCACGGTAGCCAGTGTTCGAAGCATCACG
TCGAGGGATCGTCTTGCCAAGTACGACCCTGCTGCCTTCAAGCTTGTCCTTGTCGACGAAGCCCACCACATTGTC
GCTTCAAGCTACCTACGCACTCTCAAGCACTTTGGTCTCGACCAGAAGCAAGCAGAGTCGCCCACGCTTGTTGGC
GTGTCGGCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCACTGCTATTGACGAGATTGTCTACCACAAGGAC
TATATCGACATGATCGAGGACAAGTGGCTGGCGGATGTCATGCTGACTACGGTTGAATCCAAGGCAAACCTGTCA
AAGGTTCGCAGCAATGCTAGTGGCGACTTCCAAACCGGAGACCTGTCAAACGTGGTCAACACGGAAGAGGTCAAT
GAAATCGCTGTTCGCAGCTGGATAGCCAAGGCCTCTGACCGTAAATCAACTCTGGTATTCTGCGTCGACCTCGCC
CATGTTGCTGGCTTGACCCAAAAGTTTCGTGAATATGGCTTCGACGCAAGGTCTGTTACAGGAGACACGCCCAAG
CTACAACGAAGCTGCACTCTAGACGCTTTCAAAGCCGGCCATTATCCTATCCTTGTTAACTGCGGCGTCTTTACT
GAGGGCACCGACATCCCAAATATTGACTGCATCGTCATTAGCCGCCCGACTAGATCACGCAACTTGCTCGTACAA
ATGATAGGTCGAGGCATGCGCCTCCATCCAGGCAAACAGAACTGCCACATTATTGATATCGTCTCAAGTCTAGAG
ACGGGCATCATCACGACACCTACCCTCTTCGGCCTCGATCCAAATTTGCTGGTGGACAAAGTGTCCGTCACGAAA
ATCAAGGATCAAAAATTTCAGGACAGCCCTGATCAACAGCAAGCAAGTAGAACAGATTCAACAATTGCCTCAAAC
AGCCCTATAATCTTCACCGAGTACTCATCCGTACTTGATCTCATTGCCGATACATCGGGCGAGAAACACATTCGT
GCCATCAGCCAGAATGCCTGGATCCAGTCCGCTCCCGATAGCTATGTCCTTTCGGCCCCAAGCGGCTCTTACATT
CGACTCGAGCGTATTCAAGAAGAAGCCATCACCAAGCCAACCGCTTGGTATCGCGCCGTAGAGGTGCGCGCTCTT
CCTCCCGGCTTGTGCAAGTCGCCATTTGCCGCACGCAGAGAGATTCTTACTGCGGCCACTTTTGAAGACGCTGTT
CACGGCGCAGACCGTTATGCAGCAGACGCCTTTCCCTACACTTTCATCAATCGACACCAGCCTTGGCGCTCGCTC
CCAGCAACTCAGGGTCAACTCAACTTCATCAACAAGATACGTGGCAAGGCTGAGCCCTTAATAGCAGCCGAGTTG
ACAAAGGGAAGAGCAGCAGATATGATTACTAAAATCAAGCATGGAGCCCGCGGCCAATTCAACAAAATCGAAGCT
GAGCAGCGAAGACGCCTCAGACAAGCTTCCATGATGGATGCTAGACGAAACCGCGAAGTCGTTAGGGTCGGGCCT
GTGGCAGCTTGA
Gene >OphauG2|4430
ATGCGCCCAACCTCACAATCACAGCTCAGCAGAGCATCGACACTGGCTACCAAGTTGACGCTGAGAGACTACCAG
CTCGAATGCATCCGCTCTGTCATTGCATCGCTCGGGCGAGGCCATAAGCGAGTTGGAATCTCTTTGGCTACCGGT
AGCGGCAAAACAGTCTGTATACACTATTCTGCATTTTGCTCCTATTTGCCGGGGCATTTTTCTTCTCCTTGTTAC
TTACCTGATAGCATTTCGCCTTTGCCTCTTTGTCCTCACCCTCCAACTCGTCTCGTCCTGTTTTGAAAGCTGACA
TGCCCTCTAGGTCATCTTCACTCAGCTCATCGACCAAGTCGGCCCGCGATTCGACGGCAAAGGAGACCGCACTCT
CATCTTGGCCCATCGCTGCGAATTGGTAGAGCAAGCTGCTCGCCAATGCCAGCTGGCGTATCCAGACAAGACAAT
CGACATCGAAATGGGCTCTCTTCACGCCTCAGGCACAGCCGACATCACGGTAGCCAGTGTTCGAAGCATCACGTC
GAGGGATCGTCTTGCCAAGTACGACCCTGCTGCCTTCAAGCTTGTCCTTGTCGACGAAGCCCACCACATTGTCGC
TTCAAGCTACCTACGCACTCTCAAGCACTTTGGTCTCGACCAGAAGCAAGCAGAGTCGCCCACGCTTGTTGGCGT
GTCGGCCACTTTCTCTCGCTTCGATGGCCTCAAACTCGGCACTGCTATTGACGAGATTGTCTACCACAAGGACTA
TATCGACATGATCGAGGACAAGTGGCTGGCGGATGTCATGCTGACTACGGTTGAATCCAAGGCAAACCTGTCAAA
GGTTCGCAGCAATGCTAGTGGCGACTTCCAAACCGGAGACCTGTCAAACGTGGTCAACACGGAAGAGGTCAATGA
AATCGCTGTTCGCAGCTGGATAGCCAAGGCCTCTGACCGTAAATCAACTCTGGTATTCTGCGTCGACCTCGCCCA
TGTTGCTGGCTTGACCCAAAAGTTTCGTGAATATGGCTTCGACGCAAGGTCTGTTACAGGAGACACGCCCAAGCT
ACAACGAAGCTGCACTCTAGACGCTTTCAAAGCCGGCCATTATCCTATCCTTGTTAACTGCGGCGTCTTTACTGA
GGGCACCGACATCCCAAATATTGACTGCATCGTCATTAGCCGCCCGACTAGATCACGCAACTTGCTCGTACAAAT
GATAGGTCGAGGCATGCGCCTCCATCCAGGCAAACAGAACTGCCACATTATTGATATCGTCTCAAGTCTAGAGAC
GGGCATCATCACGACACCTACCCTCTTCGGCCTCGATCCAAATTTGCTGGTGGACAAAGTGTCCGTCACGAAAAT
CAAGGATCAAAAATTTCAGGACAGCCCTGATCAACAGCAAGCAAGTAGAACAGATTCAACAATTGCCTCAAACAG
CCCTATAATCTTCACCGAGTACTCATCCGTACTTGATCTCATTGCCGATACATCGGGCGAGAAACACATTCGTGC
CATCAGCCAGAATGCCTGGATCCAGTCCGCTCCCGATAGCTATGTCCTTTCGGCCCCAAGCGGCTCTTACATTCG
ACTCGAGCGTATTCAAGAAGAAGCCATCACCAAGCCAACCGCTTGGTATCGCGCCGTAGAGGTGCGCGCTCTTCC
TCCCGGCTTGTGCAAGTCGCCATTTGCCGCACGCAGAGAGATTCTTACTGCGGCCACTTTTGAAGACGCTGTTCA
CGGCGCAGACCGTTATGCAGCAGACGCCTTTCCCTACACTTTCATCAATCGACACCAGCCTTGGCGCTCGCTCCC
AGCAACTCAGGGTCAACTCAACTTCATCAACAAGATACGTGGCAAGGCTGAGCCCTTAATAGCAGCCGAGTTGAC
AAAGGGAAGAGCAGCAGATATGATTACTAAAATCAAGCATGGAGCCCGCGGCCAATTCAACAAAATCGAAGCTGA
GCAGCGAAGACGCCTCAGACAAGCTTCCATGATGGATGCTAGACGAAACCGCGAAGTCGTTAGGGTCGGGCCTGT
GGCAGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail