Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4427
Gene name
LocationContig_37:33972..36904
Strand-
Gene length (bp)2932
Transcript length (bp)2862
Coding sequence length (bp)2862
Protein length (aa) 954

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 5.0E-62 580 949
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 3.9E-26 171 448

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96RT7|GCP6_HUMAN Gamma-tubulin complex component 6 OS=Homo sapiens GN=TUBGCP6 PE=1 SV=3 676 949 2.0E-08

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2151
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4427 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1168
Ophiocordyceps camponoti-floridani Ophcf2|04150
Ophiocordyceps camponoti-rufipedis Ophun1|4051
Ophiocordyceps kimflemingae Ophio5|3007
Ophiocordyceps subramaniannii Hirsu2|2622

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4427
METDLLEADVFAIPDFGQTCQWMTGNGEATSLLFPLVPYLDNDLHDSFLPSSPPKQDGFFQLPLGLAASQPPHPR
PCLDRDVLIVDSMADIASTVDDVWTVLEGVPAKQAKLRTWETFHVVSKSQSAAHQRPMLLSEAGSLAFDALVKSA
DEPLASGSHGIVTVKTQSYISSLLAMALGRDSLLFRKDEATGTFQSILGMCRISGLSGQTLQGVERQALCCGSAL
LYLAAFVHRTYTIRSSPCQVALASCIDQVLRAAQIRAALDARTFWSVLQLQLFINNVSALLAPLKVLTSKLPSQC
SDKDILDAVYDAASSQGNSQDSVQKMMREILQRVSAPWIEFLEEWIGLRKEQGAPLTLGCEQSGKCFIKIDTGVD
IDHFGNEEDTAEFCLDPLNVPGFMSDDIMDLILDAGRNLRFIREFHPNHPLVQQPVFRHIQLPNVQWLYDWESIL
NVEKQIVQYRQSIGVSMQQISGHTWSGPQDSGLVPNGASVLGLNWDSLKEQVSTSMEHFSMPLKGPEVDDSVGRL
VLEHLGDRHQRCDDKVDDTAHWSLLPGVSFANIAATQARIFSQESLRLLFDSHDLCLHLRMLRDFHLLGSGFFSN
RLSHALFDSSLESTERKTGVARRGGVMGLGLGGRENWPPASSELQLALMSVLTESYAEGAGAELRRERSHHDGSH
KGSTTSLPGDVSFAIRDLAPEQMDKATNPDKIEALDFLGLSYKPPREIAAVITRHSLVRHDEIFKLLLRVLRMLY
VVDEQCCNVCLGNRSASGRLDKISYRFAREAQHLIKTLASHFMDVGVAIPWRLFENKVEQVRAMLGSDDSKYASD
SRMQSPEGLGQLHQEVLERIACVLLLNKRQEPALKLIEELFDLVLRHDKLLKPRALERSVQNDDSVEIAQLYATF
EEKMKTFVAVCRVMSEKMGSVGDEAGEIGSGQDGLLEQLLVRLNFDSYYGEPM*
Coding >OphauG2|4427
ATGGAAACAGACCTTCTTGAGGCTGATGTTTTTGCCATACCCGATTTTGGACAAACGTGCCAATGGATGACAGGA
AATGGCGAGGCAACGTCGCTCTTGTTTCCCTTGGTCCCATACCTCGACAATGACTTGCATGATAGCTTCCTGCCA
TCTTCGCCTCCCAAACAGGATGGATTTTTCCAGCTACCCCTCGGTCTGGCTGCAAGCCAACCGCCACACCCTCGA
CCTTGTCTGGACCGTGACGTTCTAATTGTCGACAGCATGGCCGACATAGCATCAACTGTCGATGACGTCTGGACT
GTTTTGGAAGGTGTGCCCGCCAAACAAGCCAAGCTGAGAACATGGGAAACCTTTCACGTCGTTTCAAAGAGTCAA
TCTGCTGCTCATCAGAGACCAATGCTGCTCAGCGAAGCCGGCTCTCTGGCATTTGATGCCCTGGTCAAGTCGGCG
GACGAACCCCTTGCATCCGGGAGCCATGGCATTGTTACAGTCAAGACTCAATCCTACATATCTTCCTTGTTGGCT
ATGGCTCTAGGTCGCGACTCCTTGCTCTTTCGGAAAGACGAGGCTACGGGCACTTTCCAGTCAATACTGGGCATG
TGTCGAATATCAGGCTTGTCTGGTCAAACGCTGCAGGGTGTAGAACGCCAGGCTCTTTGCTGTGGCTCAGCCTTG
TTGTATCTTGCCGCATTTGTCCACCGCACGTACACAATTCGCTCGAGTCCTTGCCAGGTTGCTCTGGCCAGCTGT
ATTGATCAAGTCTTGCGCGCAGCACAAATTAGGGCAGCTCTGGATGCTCGGACCTTTTGGTCCGTCCTACAACTT
CAGCTCTTCATCAATAATGTGTCGGCCCTCCTGGCTCCGCTGAAAGTGCTCACCTCGAAACTTCCATCACAATGC
TCTGACAAAGACATTCTTGATGCAGTCTATGATGCGGCGTCGTCGCAGGGCAACAGTCAAGATAGCGTCCAAAAG
ATGATGCGAGAAATATTACAGCGTGTGTCAGCGCCTTGGATCGAATTTCTGGAGGAATGGATTGGATTGAGGAAG
GAACAAGGCGCTCCTTTAACTCTTGGTTGCGAACAAAGTGGTAAATGCTTCATCAAGATAGATACGGGCGTCGAC
ATAGACCATTTTGGCAACGAGGAAGACACGGCTGAGTTCTGCTTGGATCCACTCAATGTTCCAGGCTTCATGTCC
GACGACATTATGGATTTGATACTCGACGCGGGACGAAACTTGAGATTCATTCGCGAATTCCATCCCAATCACCCA
TTGGTGCAGCAGCCTGTGTTTAGGCACATCCAATTGCCGAATGTCCAGTGGCTCTATGACTGGGAGTCGATACTC
AACGTTGAGAAGCAAATTGTACAATATCGTCAAAGTATTGGCGTCTCTATGCAGCAAATATCTGGACACACATGG
TCTGGTCCTCAGGATTCTGGGCTCGTACCTAATGGAGCAAGCGTCCTTGGACTGAATTGGGATAGCCTAAAAGAA
CAAGTATCAACGTCCATGGAGCACTTCTCTATGCCCTTAAAAGGGCCCGAGGTCGACGATTCCGTGGGCAGATTG
GTCCTCGAGCACCTTGGTGATAGACACCAAAGATGCGACGACAAAGTCGATGATACAGCGCATTGGTCGTTGCTC
CCCGGTGTGTCGTTTGCAAATATTGCTGCGACGCAGGCTCGGATTTTCAGTCAAGAAAGTCTCCGGCTTCTTTTT
GATTCTCATGATCTATGTCTTCATCTGAGAATGCTGCGCGACTTCCATTTACTCGGGAGTGGCTTCTTTTCCAAC
AGACTCTCACATGCACTCTTTGACTCGAGTCTTGAGTCAACGGAGAGAAAGACAGGCGTGGCTCGGCGAGGTGGC
GTCATGGGACTTGGACTAGGAGGACGAGAAAATTGGCCGCCTGCCAGCTCAGAGCTGCAGCTGGCACTGATGTCC
GTGCTCACTGAAAGTTATGCGGAAGGCGCTGGGGCAGAGTTGCGAAGAGAAAGGAGTCATCATGATGGTTCTCAT
AAAGGCTCGACAACTAGTCTGCCTGGAGACGTCAGCTTTGCAATTCGAGACCTGGCGCCTGAACAAATGGACAAA
GCAACAAATCCCGACAAGATTGAAGCCTTGGATTTTCTGGGACTTTCCTACAAGCCTCCACGAGAAATAGCTGCA
GTCATTACTCGGCACAGTCTTGTTCGTCATGATGAAATCTTCAAACTGCTACTCCGCGTGCTGCGGATGCTGTAC
GTTGTCGATGAACAGTGTTGCAATGTTTGTTTGGGCAACAGAAGCGCGTCGGGGCGTCTTGACAAGATTTCTTAT
CGTTTTGCTCGAGAAGCACAGCACTTGATCAAGACACTGGCATCACACTTTATGGATGTGGGTGTGGCCATACCA
TGGAGGCTTTTTGAGAACAAGGTGGAGCAAGTGAGAGCTATGCTAGGTAGCGACGATTCAAAGTATGCAAGTGAC
AGCCGAATGCAGAGCCCCGAGGGACTTGGACAACTGCATCAAGAGGTGCTTGAGCGCATCGCATGTGTGCTCTTG
CTCAACAAGAGACAAGAGCCAGCGCTCAAGTTGATTGAAGAACTCTTTGACCTCGTACTGCGCCATGACAAGCTA
CTCAAGCCAAGGGCTTTGGAAAGGTCTGTGCAGAACGACGACAGTGTCGAGATAGCGCAACTGTATGCGACCTTT
GAAGAGAAAATGAAGACGTTTGTGGCTGTCTGTCGCGTCATGTCGGAGAAGATGGGGAGTGTCGGCGATGAAGCG
GGAGAGATTGGGTCTGGACAAGACGGCCTGCTTGAGCAGTTGCTTGTCAGGCTGAACTTTGACAGCTACTATGGC
GAGCCCATGTAG
Transcript >OphauG2|4427
ATGGAAACAGACCTTCTTGAGGCTGATGTTTTTGCCATACCCGATTTTGGACAAACGTGCCAATGGATGACAGGA
AATGGCGAGGCAACGTCGCTCTTGTTTCCCTTGGTCCCATACCTCGACAATGACTTGCATGATAGCTTCCTGCCA
TCTTCGCCTCCCAAACAGGATGGATTTTTCCAGCTACCCCTCGGTCTGGCTGCAAGCCAACCGCCACACCCTCGA
CCTTGTCTGGACCGTGACGTTCTAATTGTCGACAGCATGGCCGACATAGCATCAACTGTCGATGACGTCTGGACT
GTTTTGGAAGGTGTGCCCGCCAAACAAGCCAAGCTGAGAACATGGGAAACCTTTCACGTCGTTTCAAAGAGTCAA
TCTGCTGCTCATCAGAGACCAATGCTGCTCAGCGAAGCCGGCTCTCTGGCATTTGATGCCCTGGTCAAGTCGGCG
GACGAACCCCTTGCATCCGGGAGCCATGGCATTGTTACAGTCAAGACTCAATCCTACATATCTTCCTTGTTGGCT
ATGGCTCTAGGTCGCGACTCCTTGCTCTTTCGGAAAGACGAGGCTACGGGCACTTTCCAGTCAATACTGGGCATG
TGTCGAATATCAGGCTTGTCTGGTCAAACGCTGCAGGGTGTAGAACGCCAGGCTCTTTGCTGTGGCTCAGCCTTG
TTGTATCTTGCCGCATTTGTCCACCGCACGTACACAATTCGCTCGAGTCCTTGCCAGGTTGCTCTGGCCAGCTGT
ATTGATCAAGTCTTGCGCGCAGCACAAATTAGGGCAGCTCTGGATGCTCGGACCTTTTGGTCCGTCCTACAACTT
CAGCTCTTCATCAATAATGTGTCGGCCCTCCTGGCTCCGCTGAAAGTGCTCACCTCGAAACTTCCATCACAATGC
TCTGACAAAGACATTCTTGATGCAGTCTATGATGCGGCGTCGTCGCAGGGCAACAGTCAAGATAGCGTCCAAAAG
ATGATGCGAGAAATATTACAGCGTGTGTCAGCGCCTTGGATCGAATTTCTGGAGGAATGGATTGGATTGAGGAAG
GAACAAGGCGCTCCTTTAACTCTTGGTTGCGAACAAAGTGGTAAATGCTTCATCAAGATAGATACGGGCGTCGAC
ATAGACCATTTTGGCAACGAGGAAGACACGGCTGAGTTCTGCTTGGATCCACTCAATGTTCCAGGCTTCATGTCC
GACGACATTATGGATTTGATACTCGACGCGGGACGAAACTTGAGATTCATTCGCGAATTCCATCCCAATCACCCA
TTGGTGCAGCAGCCTGTGTTTAGGCACATCCAATTGCCGAATGTCCAGTGGCTCTATGACTGGGAGTCGATACTC
AACGTTGAGAAGCAAATTGTACAATATCGTCAAAGTATTGGCGTCTCTATGCAGCAAATATCTGGACACACATGG
TCTGGTCCTCAGGATTCTGGGCTCGTACCTAATGGAGCAAGCGTCCTTGGACTGAATTGGGATAGCCTAAAAGAA
CAAGTATCAACGTCCATGGAGCACTTCTCTATGCCCTTAAAAGGGCCCGAGGTCGACGATTCCGTGGGCAGATTG
GTCCTCGAGCACCTTGGTGATAGACACCAAAGATGCGACGACAAAGTCGATGATACAGCGCATTGGTCGTTGCTC
CCCGGTGTGTCGTTTGCAAATATTGCTGCGACGCAGGCTCGGATTTTCAGTCAAGAAAGTCTCCGGCTTCTTTTT
GATTCTCATGATCTATGTCTTCATCTGAGAATGCTGCGCGACTTCCATTTACTCGGGAGTGGCTTCTTTTCCAAC
AGACTCTCACATGCACTCTTTGACTCGAGTCTTGAGTCAACGGAGAGAAAGACAGGCGTGGCTCGGCGAGGTGGC
GTCATGGGACTTGGACTAGGAGGACGAGAAAATTGGCCGCCTGCCAGCTCAGAGCTGCAGCTGGCACTGATGTCC
GTGCTCACTGAAAGTTATGCGGAAGGCGCTGGGGCAGAGTTGCGAAGAGAAAGGAGTCATCATGATGGTTCTCAT
AAAGGCTCGACAACTAGTCTGCCTGGAGACGTCAGCTTTGCAATTCGAGACCTGGCGCCTGAACAAATGGACAAA
GCAACAAATCCCGACAAGATTGAAGCCTTGGATTTTCTGGGACTTTCCTACAAGCCTCCACGAGAAATAGCTGCA
GTCATTACTCGGCACAGTCTTGTTCGTCATGATGAAATCTTCAAACTGCTACTCCGCGTGCTGCGGATGCTGTAC
GTTGTCGATGAACAGTGTTGCAATGTTTGTTTGGGCAACAGAAGCGCGTCGGGGCGTCTTGACAAGATTTCTTAT
CGTTTTGCTCGAGAAGCACAGCACTTGATCAAGACACTGGCATCACACTTTATGGATGTGGGTGTGGCCATACCA
TGGAGGCTTTTTGAGAACAAGGTGGAGCAAGTGAGAGCTATGCTAGGTAGCGACGATTCAAAGTATGCAAGTGAC
AGCCGAATGCAGAGCCCCGAGGGACTTGGACAACTGCATCAAGAGGTGCTTGAGCGCATCGCATGTGTGCTCTTG
CTCAACAAGAGACAAGAGCCAGCGCTCAAGTTGATTGAAGAACTCTTTGACCTCGTACTGCGCCATGACAAGCTA
CTCAAGCCAAGGGCTTTGGAAAGGTCTGTGCAGAACGACGACAGTGTCGAGATAGCGCAACTGTATGCGACCTTT
GAAGAGAAAATGAAGACGTTTGTGGCTGTCTGTCGCGTCATGTCGGAGAAGATGGGGAGTGTCGGCGATGAAGCG
GGAGAGATTGGGTCTGGACAAGACGGCCTGCTTGAGCAGTTGCTTGTCAGGCTGAACTTTGACAGCTACTATGGC
GAGCCCATGTAG
Gene >OphauG2|4427
ATGGAAACAGACCTTCTTGAGGCTGATGTTTTTGCCATACCCGATTTTGGACAAACGTGCCAATGGATGACAGGA
AATGGCGAGGCAACGTCGCTCTTGTTTCCCTTGGTCCCATACCTCGACAGTGAGTTATAGCTCATTGCACTATTC
ACATGCTCTGTGTCGTGGTAGTAGCTAACTTGAAACCGTGCCAGATGACTTGCATGATAGCTTCCTGCCATCTTC
GCCTCCCAAACAGGATGGATTTTTCCAGCTACCCCTCGGTCTGGCTGCAAGCCAACCGCCACACCCTCGACCTTG
TCTGGACCGTGACGTTCTAATTGTCGACAGCATGGCCGACATAGCATCAACTGTCGATGACGTCTGGACTGTTTT
GGAAGGTGTGCCCGCCAAACAAGCCAAGCTGAGAACATGGGAAACCTTTCACGTCGTTTCAAAGAGTCAATCTGC
TGCTCATCAGAGACCAATGCTGCTCAGCGAAGCCGGCTCTCTGGCATTTGATGCCCTGGTCAAGTCGGCGGACGA
ACCCCTTGCATCCGGGAGCCATGGCATTGTTACAGTCAAGACTCAATCCTACATATCTTCCTTGTTGGCTATGGC
TCTAGGTCGCGACTCCTTGCTCTTTCGGAAAGACGAGGCTACGGGCACTTTCCAGTCAATACTGGGCATGTGTCG
AATATCAGGCTTGTCTGGTCAAACGCTGCAGGGTGTAGAACGCCAGGCTCTTTGCTGTGGCTCAGCCTTGTTGTA
TCTTGCCGCATTTGTCCACCGCACGTACACAATTCGCTCGAGTCCTTGCCAGGTTGCTCTGGCCAGCTGTATTGA
TCAAGTCTTGCGCGCAGCACAAATTAGGGCAGCTCTGGATGCTCGGACCTTTTGGTCCGTCCTACAACTTCAGCT
CTTCATCAATAATGTGTCGGCCCTCCTGGCTCCGCTGAAAGTGCTCACCTCGAAACTTCCATCACAATGCTCTGA
CAAAGACATTCTTGATGCAGTCTATGATGCGGCGTCGTCGCAGGGCAACAGTCAAGATAGCGTCCAAAAGATGAT
GCGAGAAATATTACAGCGTGTGTCAGCGCCTTGGATCGAATTTCTGGAGGAATGGATTGGATTGAGGAAGGAACA
AGGCGCTCCTTTAACTCTTGGTTGCGAACAAAGTGGTAAATGCTTCATCAAGATAGATACGGGCGTCGACATAGA
CCATTTTGGCAACGAGGAAGACACGGCTGAGTTCTGCTTGGATCCACTCAATGTTCCAGGCTTCATGTCCGACGA
CATTATGGATTTGATACTCGACGCGGGACGAAACTTGAGATTCATTCGCGAATTCCATCCCAATCACCCATTGGT
GCAGCAGCCTGTGTTTAGGCACATCCAATTGCCGAATGTCCAGTGGCTCTATGACTGGGAGTCGATACTCAACGT
TGAGAAGCAAATTGTACAATATCGTCAAAGTATTGGCGTCTCTATGCAGCAAATATCTGGACACACATGGTCTGG
TCCTCAGGATTCTGGGCTCGTACCTAATGGAGCAAGCGTCCTTGGACTGAATTGGGATAGCCTAAAAGAACAAGT
ATCAACGTCCATGGAGCACTTCTCTATGCCCTTAAAAGGGCCCGAGGTCGACGATTCCGTGGGCAGATTGGTCCT
CGAGCACCTTGGTGATAGACACCAAAGATGCGACGACAAAGTCGATGATACAGCGCATTGGTCGTTGCTCCCCGG
TGTGTCGTTTGCAAATATTGCTGCGACGCAGGCTCGGATTTTCAGTCAAGAAAGTCTCCGGCTTCTTTTTGATTC
TCATGATCTATGTCTTCATCTGAGAATGCTGCGCGACTTCCATTTACTCGGGAGTGGCTTCTTTTCCAACAGACT
CTCACATGCACTCTTTGACTCGAGTCTTGAGTCAACGGAGAGAAAGACAGGCGTGGCTCGGCGAGGTGGCGTCAT
GGGACTTGGACTAGGAGGACGAGAAAATTGGCCGCCTGCCAGCTCAGAGCTGCAGCTGGCACTGATGTCCGTGCT
CACTGAAAGTTATGCGGAAGGCGCTGGGGCAGAGTTGCGAAGAGAAAGGAGTCATCATGATGGTTCTCATAAAGG
CTCGACAACTAGTCTGCCTGGAGACGTCAGCTTTGCAATTCGAGACCTGGCGCCTGAACAAATGGACAAAGCAAC
AAATCCCGACAAGATTGAAGCCTTGGATTTTCTGGGACTTTCCTACAAGCCTCCACGAGAAATAGCTGCAGTCAT
TACTCGGCACAGTCTTGTTCGTCATGATGAAATCTTCAAACTGCTACTCCGCGTGCTGCGGATGCTGTACGTTGT
CGATGAACAGTGTTGCAATGTTTGTTTGGGCAACAGAAGCGCGTCGGGGCGTCTTGACAAGATTTCTTATCGTTT
TGCTCGAGAAGCACAGCACTTGATCAAGACACTGGCATCACACTTTATGGATGTGGGTGTGGCCATACCATGGAG
GCTTTTTGAGAACAAGGTGGAGCAAGTGAGAGCTATGCTAGGTAGCGACGATTCAAAGTATGCAAGTGACAGCCG
AATGCAGAGCCCCGAGGGACTTGGACAACTGCATCAAGAGGTGCTTGAGCGCATCGCATGTGTGCTCTTGCTCAA
CAAGAGACAAGAGCCAGCGCTCAAGTTGATTGAAGAACTCTTTGACCTCGTACTGCGCCATGACAAGCTACTCAA
GCCAAGGGCTTTGGAAAGGTCTGTGCAGAACGACGACAGTGTCGAGATAGCGCAACTGTATGCGACCTTTGAAGA
GAAAATGAAGACGTTTGTGGCTGTCTGTCGCGTCATGTCGGAGAAGATGGGGAGTGTCGGCGATGAAGCGGGAGA
GATTGGGTCTGGACAAGACGGCCTGCTTGAGCAGTTGCTTGTCAGGCTGAACTTTGACAGCTACTATGGCGAGCC
CATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail