Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4414
Gene name
LocationContig_369:11787..14263
Strand+
Gene length (bp)2476
Transcript length (bp)2400
Coding sequence length (bp)2400
Protein length (aa) 800

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 1.7E-216 94 625
PF17048 Ceramidse_alk_C Neutral/alkaline non-lysosomal ceramidase, C-terminal 2.8E-56 632 797

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 94 778 7.0E-155
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 94 797 7.0E-145
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 94 797 5.0E-143
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 94 797 5.0E-139
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 94 797 5.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q304B9|NCASE_ARATH Neutral ceramidase OS=Arabidopsis thaliana GN=At2g38010 PE=3 SV=1 94 778 7.0E-155
sp|Q9JHE3|ASAH2_MOUSE Neutral ceramidase OS=Mus musculus GN=Asah2 PE=1 SV=1 94 797 7.0E-145
sp|Q9NR71|ASAH2_HUMAN Neutral ceramidase OS=Homo sapiens GN=ASAH2 PE=1 SV=2 94 797 5.0E-143
sp|Q0JL46|NCASE_ORYSJ Neutral ceramidase OS=Oryza sativa subsp. japonica GN=Os01g0624000 PE=1 SV=1 94 797 5.0E-139
sp|Q91XT9|ASAH2_RAT Neutral ceramidase OS=Rattus norvegicus GN=Asah2 PE=1 SV=1 94 797 5.0E-138
sp|Q5W7F1|ASAH2_DANRE Neutral ceramidase OS=Danio rerio GN=asah2 PE=1 SV=1 90 799 5.0E-137
sp|Q9VA70|NCASE_DROME Neutral ceramidase OS=Drosophila melanogaster GN=CDase PE=1 SV=1 94 797 2.0E-135
sp|Q29C43|NCASE_DROPS Neutral ceramidase OS=Drosophila pseudoobscura pseudoobscura GN=CDase PE=3 SV=1 94 797 4.0E-135
sp|Q55G11|NCSEB_DICDI Neutral ceramidase B OS=Dictyostelium discoideum GN=dcd2B PE=3 SV=1 94 797 8.0E-132
sp|Q54BK2|NCSEA_DICDI Neutral ceramidase A OS=Dictyostelium discoideum GN=dcd2A PE=1 SV=1 94 797 3.0E-126
sp|Q9I596|NCASE_PSEAE Neutral ceramidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0845 PE=1 SV=1 94 797 4.0E-96
sp|O06769|NCASE_MYCTU Neutral ceramidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0669c PE=1 SV=1 96 797 7.0E-81
sp|P0C7U1|ASA2B_HUMAN Putative inactive neutral ceramidase B OS=Homo sapiens GN=ASAH2B PE=2 SV=1 666 797 2.0E-18
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup74
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|149
Ophiocordyceps australis 1348a (Ghana) OphauG2|4414 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|5649
Ophiocordyceps australis map64 (Brazil) OphauB2|502
Ophiocordyceps australis map64 (Brazil) OphauB2|5266
Ophiocordyceps australis map64 (Brazil) OphauB2|7887
Ophiocordyceps camponoti-floridani Ophcf2|01033
Ophiocordyceps camponoti-floridani Ophcf2|01218
Ophiocordyceps camponoti-floridani Ophcf2|02102
Ophiocordyceps camponoti-rufipedis Ophun1|1793
Ophiocordyceps camponoti-rufipedis Ophun1|6086
Ophiocordyceps kimflemingae Ophio5|1151
Ophiocordyceps kimflemingae Ophio5|2727
Ophiocordyceps kimflemingae Ophio5|723
Ophiocordyceps subramaniannii Hirsu2|3661
Ophiocordyceps subramaniannii Hirsu2|7981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4414
MAPAPAKASPARHVQAPARWKPLSSLHLCRTHCLGFGLILLLASLLALVRAPAWTNQGLLSSHPDLQGADATIRP
SNAWAGHQLPPGHWPQDRFLVGAGKADITGPVVELNMMGYADVKQVGSGVRQRLYSRAFIIGSLHHAQDRFVYLV
LDIQSGDTAVRYGILRGLAALGPRYSMYGHDNIAVTATHSHSGPGAWLNYLLPQITSKGFDRQSYRAIVEGCVLS
IRRAHESLEPGSLSLGTTSVLGAGINRSMFAYLANPEAERARYNVSASHDGSVETDMTLLKLQRESDGKNIGILT
WFPTHGTSMQANNTLITGDNKGLAADLFEKQVRGGLNETDSFVAGFSQANMGDVTPNILGAWCNDGTGHSCRFED
STCPDGRSNNCRARGPGLVNDDQGVSSCYEIAKRQYEGALRIYKSLSQEAPNVRGDSVKAFHHFQDMSTFRFNLA
NGTAVRTCPAALGYSFGAGTWDEPGRFDLVQHLSAKTKSSPVWSALTWMLKAPGPEQVECQHPKSVLLDVGEVKR
PYEWTPNIVDIQTLRVGQLIMIVSPGEATTMAGRRWKEAVAKESIEVLGHELQGQDPVVVIGAPSNSYTHYITTE
EEYGIQRYEGASTLYGKHTLAAYINRSLVSLQYLRAHGAPPREVLGPRVLPPDNSNRSLSFIAGVVYDRTPWSLH
FGDVVSDVAKRQLQRGETARATFVGANPRNNLRLEQTYAAVEHWQSEKNEWRRVRDDSDWELTFHWRRTNKLLGT
SEATVAWRIEPWAAAGQYRLRYYGDYKAALGRGRIEGFQGVSRVFRVNR*
Coding >OphauG2|4414
ATGGCACCGGCCCCGGCCAAAGCTAGTCCAGCCCGCCATGTCCAGGCCCCGGCCAGATGGAAGCCATTGTCGAGC
TTGCACCTATGCCGCACCCACTGCCTCGGCTTTGGGCTCATTTTACTCCTCGCCAGCCTCTTGGCCCTTGTGCGA
GCTCCCGCCTGGACCAACCAGGGCCTCCTCTCGTCGCACCCAGACCTGCAAGGCGCCGACGCCACTATACGCCCA
AGCAATGCCTGGGCAGGCCACCAACTGCCCCCCGGCCATTGGCCCCAGGACCGTTTCCTGGTGGGCGCCGGCAAG
GCCGACATTACCGGCCCCGTTGTCGAGCTCAACATGATGGGCTACGCCGACGTCAAGCAAGTCGGCAGCGGCGTG
CGTCAGCGCCTCTACTCGCGTGCATTTATTATTGGGAGTCTCCACCACGCCCAGGATCGCTTTGTCTACTTGGTG
CTTGATATCCAGTCTGGGGATACGGCTGTTCGCTACGGCATCTTGCGGGGTCTGGCCGCCCTGGGTCCCCGCTAC
TCCATGTACGGCCACGACAACATTGCCGTCACCGCTACCCACTCACACTCTGGACCCGGTGCCTGGCTCAACTAT
CTGCTGCCTCAAATCACCAGCAAAGGCTTTGACCGCCAGAGCTATCGCGCAATTGTTGAAGGATGTGTTTTGTCG
ATTCGCCGCGCCCACGAGAGCCTCGAGCCCGGCTCGCTGAGTCTTGGCACCACGAGCGTTCTGGGTGCCGGGATT
AACCGCAGCATGTTTGCCTATCTAGCCAATCCTGAGGCTGAGCGCGCTCGCTACAATGTCAGTGCTAGCCATGAC
GGCTCTGTTGAGACGGACATGACGCTGCTCAAGCTTCAGCGCGAGTCGGATGGCAAGAATATTGGCATCTTGACT
TGGTTCCCCACCCATGGCACTTCGATGCAGGCCAACAATACCCTCATTACGGGCGACAATAAGGGACTGGCTGCC
GATTTATTTGAGAAGCAAGTTCGCGGGGGGTTGAATGAGACGGACAGCTTTGTCGCGGGATTCTCCCAGGCCAAC
ATGGGCGATGTGACTCCCAATATTCTTGGCGCTTGGTGCAACGACGGCACGGGACACAGCTGTCGATTTGAAGAT
AGCACATGTCCCGACGGCCGCAGCAACAATTGCCGCGCTCGAGGCCCAGGTCTGGTCAACGACGACCAGGGCGTG
TCTTCGTGCTATGAGATTGCCAAGCGCCAGTACGAGGGTGCGCTGCGCATCTACAAGTCGTTGAGCCAAGAAGCC
CCCAATGTGCGCGGTGACAGCGTCAAGGCATTTCATCACTTTCAAGACATGTCGACTTTTCGCTTCAATCTCGCA
AATGGCACGGCTGTCAGAACCTGCCCCGCTGCCCTTGGATACTCATTTGGCGCTGGCACGTGGGACGAACCGGGC
AGGTTTGATCTCGTGCAGCACCTGTCAGCCAAGACCAAGTCATCGCCCGTCTGGTCAGCTCTCACGTGGATGCTC
AAGGCTCCCGGGCCAGAGCAGGTGGAATGCCAGCACCCCAAGTCTGTTCTTTTGGACGTTGGCGAGGTCAAGAGG
CCGTACGAGTGGACTCCCAATATAGTGGATATTCAAACCCTGAGGGTTGGCCAGTTGATCATGATTGTGAGTCCT
GGCGAGGCGACCACCATGGCCGGGCGCCGATGGAAAGAGGCCGTGGCAAAGGAGAGCATCGAGGTGCTGGGACAC
GAGCTCCAAGGTCAAGACCCCGTTGTTGTCATTGGTGCGCCTAGCAATAGCTATACGCATTATATTACAACCGAG
GAGGAATATGGGATACAACGCTATGAAGGAGCATCTACGCTTTACGGCAAGCACACGTTGGCCGCTTACATTAAT
CGCAGCCTGGTGTCGCTTCAGTATTTGCGAGCTCATGGGGCCCCCCCACGCGAGGTTCTAGGCCCCAGAGTATTG
CCGCCTGACAACAGCAATCGGTCGCTGAGTTTTATTGCTGGCGTTGTCTACGATCGGACACCATGGTCTCTGCAT
TTTGGAGATGTGGTGTCGGATGTGGCCAAGAGGCAACTGCAGCGCGGGGAGACGGCTAGAGCAACATTTGTCGGG
GCCAACCCGCGAAACAACTTGCGATTAGAGCAAACGTATGCGGCAGTTGAACATTGGCAGTCGGAGAAGAATGAG
TGGCGAAGAGTGCGCGACGACTCTGATTGGGAATTGACGTTTCACTGGCGGCGGACGAACAAGCTCTTGGGTACG
AGTGAAGCGACTGTAGCGTGGCGAATTGAGCCATGGGCAGCGGCAGGTCAATACCGACTGCGATATTACGGCGAC
TACAAGGCTGCGCTGGGCAGAGGCCGGATTGAGGGCTTCCAAGGTGTCAGCAGGGTGTTTAGGGTCAATAGATAA
Transcript >OphauG2|4414
ATGGCACCGGCCCCGGCCAAAGCTAGTCCAGCCCGCCATGTCCAGGCCCCGGCCAGATGGAAGCCATTGTCGAGC
TTGCACCTATGCCGCACCCACTGCCTCGGCTTTGGGCTCATTTTACTCCTCGCCAGCCTCTTGGCCCTTGTGCGA
GCTCCCGCCTGGACCAACCAGGGCCTCCTCTCGTCGCACCCAGACCTGCAAGGCGCCGACGCCACTATACGCCCA
AGCAATGCCTGGGCAGGCCACCAACTGCCCCCCGGCCATTGGCCCCAGGACCGTTTCCTGGTGGGCGCCGGCAAG
GCCGACATTACCGGCCCCGTTGTCGAGCTCAACATGATGGGCTACGCCGACGTCAAGCAAGTCGGCAGCGGCGTG
CGTCAGCGCCTCTACTCGCGTGCATTTATTATTGGGAGTCTCCACCACGCCCAGGATCGCTTTGTCTACTTGGTG
CTTGATATCCAGTCTGGGGATACGGCTGTTCGCTACGGCATCTTGCGGGGTCTGGCCGCCCTGGGTCCCCGCTAC
TCCATGTACGGCCACGACAACATTGCCGTCACCGCTACCCACTCACACTCTGGACCCGGTGCCTGGCTCAACTAT
CTGCTGCCTCAAATCACCAGCAAAGGCTTTGACCGCCAGAGCTATCGCGCAATTGTTGAAGGATGTGTTTTGTCG
ATTCGCCGCGCCCACGAGAGCCTCGAGCCCGGCTCGCTGAGTCTTGGCACCACGAGCGTTCTGGGTGCCGGGATT
AACCGCAGCATGTTTGCCTATCTAGCCAATCCTGAGGCTGAGCGCGCTCGCTACAATGTCAGTGCTAGCCATGAC
GGCTCTGTTGAGACGGACATGACGCTGCTCAAGCTTCAGCGCGAGTCGGATGGCAAGAATATTGGCATCTTGACT
TGGTTCCCCACCCATGGCACTTCGATGCAGGCCAACAATACCCTCATTACGGGCGACAATAAGGGACTGGCTGCC
GATTTATTTGAGAAGCAAGTTCGCGGGGGGTTGAATGAGACGGACAGCTTTGTCGCGGGATTCTCCCAGGCCAAC
ATGGGCGATGTGACTCCCAATATTCTTGGCGCTTGGTGCAACGACGGCACGGGACACAGCTGTCGATTTGAAGAT
AGCACATGTCCCGACGGCCGCAGCAACAATTGCCGCGCTCGAGGCCCAGGTCTGGTCAACGACGACCAGGGCGTG
TCTTCGTGCTATGAGATTGCCAAGCGCCAGTACGAGGGTGCGCTGCGCATCTACAAGTCGTTGAGCCAAGAAGCC
CCCAATGTGCGCGGTGACAGCGTCAAGGCATTTCATCACTTTCAAGACATGTCGACTTTTCGCTTCAATCTCGCA
AATGGCACGGCTGTCAGAACCTGCCCCGCTGCCCTTGGATACTCATTTGGCGCTGGCACGTGGGACGAACCGGGC
AGGTTTGATCTCGTGCAGCACCTGTCAGCCAAGACCAAGTCATCGCCCGTCTGGTCAGCTCTCACGTGGATGCTC
AAGGCTCCCGGGCCAGAGCAGGTGGAATGCCAGCACCCCAAGTCTGTTCTTTTGGACGTTGGCGAGGTCAAGAGG
CCGTACGAGTGGACTCCCAATATAGTGGATATTCAAACCCTGAGGGTTGGCCAGTTGATCATGATTGTGAGTCCT
GGCGAGGCGACCACCATGGCCGGGCGCCGATGGAAAGAGGCCGTGGCAAAGGAGAGCATCGAGGTGCTGGGACAC
GAGCTCCAAGGTCAAGACCCCGTTGTTGTCATTGGTGCGCCTAGCAATAGCTATACGCATTATATTACAACCGAG
GAGGAATATGGGATACAACGCTATGAAGGAGCATCTACGCTTTACGGCAAGCACACGTTGGCCGCTTACATTAAT
CGCAGCCTGGTGTCGCTTCAGTATTTGCGAGCTCATGGGGCCCCCCCACGCGAGGTTCTAGGCCCCAGAGTATTG
CCGCCTGACAACAGCAATCGGTCGCTGAGTTTTATTGCTGGCGTTGTCTACGATCGGACACCATGGTCTCTGCAT
TTTGGAGATGTGGTGTCGGATGTGGCCAAGAGGCAACTGCAGCGCGGGGAGACGGCTAGAGCAACATTTGTCGGG
GCCAACCCGCGAAACAACTTGCGATTAGAGCAAACGTATGCGGCAGTTGAACATTGGCAGTCGGAGAAGAATGAG
TGGCGAAGAGTGCGCGACGACTCTGATTGGGAATTGACGTTTCACTGGCGGCGGACGAACAAGCTCTTGGGTACG
AGTGAAGCGACTGTAGCGTGGCGAATTGAGCCATGGGCAGCGGCAGGTCAATACCGACTGCGATATTACGGCGAC
TACAAGGCTGCGCTGGGCAGAGGCCGGATTGAGGGCTTCCAAGGTGTCAGCAGGGTGTTTAGGGTCAATAGATAA
Gene >OphauG2|4414
ATGGCACCGGCCCCGGCCAAAGCTAGTCCAGCCCGCCATGTCCAGGCCCCGGCCAGATGGAAGCCATTGTCGAGC
TTGCACCTATGCCGCACCCACTGCCTCGGCTTTGGGCTCATTTTACTCCTCGCCAGCCTCTTGGCCCTTGTGCGA
GCTCCCGCCTGGACCAACCAGGGCCTCCTCTCGTCGCACCCAGACCTGCAAGGCGCCGACGCCACTATACGCCCA
AGCAATGCCTGGGCAGGCCACCAACTGCCCCCCGGCCATTGGCCCCAGGACCGTTTCCTGGTGGGCGCCGGCAAG
GCCGACATTACCGGCCCCGTTGTCGAGCTCAACATGATGGGCTACGCCGACGTCAAGCAAGTCGGCAGCGGCGTG
CGTCAGCGCCTCTACTCGCGTGCATTTATTATTGGGAGTCTCCACCACGCCCAGGATCGCTTTGTCTACTTGGTG
CTTGATATCCAGTCTGGGGATACGGCTGTTCGCTACGGCATCTTGCGGGGTCTGGCCGCCCTGGGTCCCCGCTAC
TCCATGTACGGCCACGACAACATTGCCGTCACCGCTACCCACTCACACTCTGGACCCGGTGCCTGGCTCAACTAT
CTGCTGCCTCAAATCACCAGCAAAGGCTTTGACCGCCAGAGCTATCGCGCAATTGTTGAAGGATGTGTTTTGTCG
ATTCGCCGCGCCCACGAGAGCCTCGAGCCCGGCTCGCTGAGTCTTGGCACCACGAGCGTTCTGGGTGCCGGGATT
AACCGCAGCATGTTTGCCTATCTAGCCAATCCTGAGGCTGAGCGCGCTCGCTACAATGTCAGTGCTAGCCATGAC
GGCTCTGTTGAGACGGACATGACGCTGCTCAAGCTTCAGCGCGAGTCGGATGGCAAGAATATTGGCATCTTGACT
TGGTTCCCCACCCATGGCACTTCGATGCAGGCCAACAATACCCTCATTACGGGCGACAATAAGGGACTGGCTGCC
GATTTATTTGAGAAGCAAGTTCGCGGGGGGTTGAATGAGACGGACAGCTTTGTCGCGGGATTCTCCCAGGCCAAC
ATGGGCGATGTGACTCCCAATATTCTTGGCGCTTGGTGCAACGACGGCACGGGACACAGCTGTCGATTTGAAGAT
AGCACATGTCCCGACGGCCGCAGCAACAATTGCCGCGCTCGAGGCCCAGGTCTGGTCAACGACGACCAGGGCGTG
TCTTCGTGCTATGAGATTGCCAAGCGCCAGTACGAGGGTGCGCTGCGCATCTACAAGTCGTTGAGCCAAGAAGCC
CCCAATGTGCGCGGTGACAGCGTCAAGGCATTTCATCACTTTCAAGACATGTCGACTTTTCGCTTCAATCTCGCA
AATGGCACGGCTGTCAGAACCTGCCCCGCTGCCCTTGGATACTCATTTGGCGCTGGCACGTGGGACGAACCGGGC
AGGTTTGATCTCGTGCAGCACCTGTCAGCCAAGACCAAGTCATCGCCCGTCTGGTCAGCTCTCACGTGGATGCTC
AAGGCTCCCGGGCCAGAGCAGGTGGAATGCCAGCACCCCAAGTCTGTTCTTTTGGACGTTGGCGAGGTCAAGAGG
CCGTACGAGTGGACTCCCAATATAGTGGATATTCAAACCCTGAGGGTTGGCCAGTTGATCATGATTGTGAGTCCT
GGCGAGGCGACCACCATGGCCGGGCGCCGATGGAAAGAGGCCGTGGCAAAGGAGAGCATCGAGGTGCTGGGACAC
GAGCTCCAAGGTCAAGACCCCGTTGTTGTCATTGGTGCGCCTAGCAATAGCTATACGCATTATATTACAACCGAG
GAGGAATATGGGTGAGTTGAGGGCAAATTGTCATGTTCCCATGTATACTTGAGCCTTATCATTGGTTCAGGTAGC
TAATTATTACAGGATACAACGCTATGAAGGAGCATCTACGCTTTACGGCAAGCACACGTTGGCCGCTTACATTAA
TCGCAGCCTGGTGTCGCTTCAGTATTTGCGAGCTCATGGGGCCCCCCCACGCGAGGTTCTAGGCCCCAGAGTATT
GCCGCCTGACAACAGCAATCGGTCGCTGAGTTTTATTGCTGGCGTTGTCTACGATCGGACACCATGGTCTCTGCA
TTTTGGAGATGTGGTGTCGGATGTGGCCAAGAGGCAACTGCAGCGCGGGGAGACGGCTAGAGCAACATTTGTCGG
GGCCAACCCGCGAAACAACTTGCGATTAGAGCAAACGTATGCGGCAGTTGAACATTGGCAGTCGGAGAAGAATGA
GTGGCGAAGAGTGCGCGACGACTCTGATTGGGAATTGACGTTTCACTGGCGGCGGACGAACAAGCTCTTGGGTAC
GAGTGAAGCGACTGTAGCGTGGCGAATTGAGCCATGGGCAGCGGCAGGTCAATACCGACTGCGATATTACGGCGA
CTACAAGGCTGCGCTGGGCAGAGGCCGGATTGAGGGCTTCCAAGGTGTCAGCAGGGTGTTTAGGGTCAATAGATA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail