Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4408
Gene name
LocationContig_368:9166..10189
Strand+
Gene length (bp)1023
Transcript length (bp)972
Coding sequence length (bp)972
Protein length (aa) 324

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13646 HEAT_2 HEAT repeats 3.8E-09 55 126
PF13646 HEAT_2 HEAT repeats 6.3E-11 215 299
PF03130 HEAT_PBS PBS lyase HEAT-like repeat 6.0E-02 227 251
PF03130 HEAT_PBS PBS lyase HEAT-like repeat 5.5E-03 259 281

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ35|DOHH_GIBZE Deoxyhypusine hydroxylase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LIA1 PE=3 SV=1 3 323 7.0E-180
sp|Q7S891|DOHH_NEUCR Deoxyhypusine hydroxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lia1 PE=3 SV=1 5 323 2.0E-168
sp|Q2H0C0|DOHH_CHAGB Deoxyhypusine hydroxylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LIA1 PE=3 SV=1 9 317 2.0E-158
sp|Q0UHL8|DOHH_PHANO Deoxyhypusine hydroxylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIA1 PE=3 SV=1 6 323 1.0E-147
sp|A1CED0|DOHH_ASPCL Deoxyhypusine hydroxylase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lia1 PE=3 SV=1 5 323 7.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ35|DOHH_GIBZE Deoxyhypusine hydroxylase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LIA1 PE=3 SV=1 3 323 7.0E-180
sp|Q7S891|DOHH_NEUCR Deoxyhypusine hydroxylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=lia1 PE=3 SV=1 5 323 2.0E-168
sp|Q2H0C0|DOHH_CHAGB Deoxyhypusine hydroxylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=LIA1 PE=3 SV=1 9 317 2.0E-158
sp|Q0UHL8|DOHH_PHANO Deoxyhypusine hydroxylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIA1 PE=3 SV=1 6 323 1.0E-147
sp|A1CED0|DOHH_ASPCL Deoxyhypusine hydroxylase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=lia1 PE=3 SV=1 5 323 7.0E-146
sp|A1DFW7|DOHH_NEOFI Deoxyhypusine hydroxylase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=lia1 PE=3 SV=1 5 323 2.0E-144
sp|Q4WHG5|DOHH_ASPFU Deoxyhypusine hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=lia1 PE=3 SV=2 5 323 3.0E-144
sp|Q1E9L2|DOHH_COCIM Deoxyhypusine hydroxylase OS=Coccidioides immitis (strain RS) GN=LIA1 PE=3 SV=1 2 320 1.0E-143
sp|A2QXL3|DOHH_ASPNC Deoxyhypusine hydroxylase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=lia1 PE=3 SV=1 2 323 6.0E-141
sp|Q5AW32|DOHH_EMENI Deoxyhypusine hydroxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lia1 PE=3 SV=1 5 323 6.0E-140
sp|Q2UMQ8|DOHH_ASPOR Deoxyhypusine hydroxylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=lia1 PE=3 SV=2 2 317 9.0E-140
sp|Q6CHJ7|DOHH_YARLI Deoxyhypusine hydroxylase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LIA1 PE=3 SV=1 1 313 9.0E-100
sp|Q59Z14|DOHH_CANAL Deoxyhypusine hydroxylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LIA1 PE=3 SV=1 5 315 6.0E-89
sp|P47120|DOHH_YEAST Deoxyhypusine hydroxylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LIA1 PE=1 SV=1 5 313 7.0E-89
sp|Q9P6K9|DOHH_SCHPO Deoxyhypusine hydroxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lia1 PE=3 SV=1 5 320 7.0E-88
sp|Q6BKA6|DOHH_DEBHA Deoxyhypusine hydroxylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LIA1 PE=3 SV=1 5 309 2.0E-87
sp|Q6CV81|DOHH_KLULA Deoxyhypusine hydroxylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LIA1 PE=3 SV=1 1 313 4.0E-86
sp|Q6FUV3|DOHH_CANGA Deoxyhypusine hydroxylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LIA1 PE=3 SV=1 5 313 5.0E-86
sp|Q7ZUX6|DOHH_DANRE Deoxyhypusine hydroxylase OS=Danio rerio GN=dohh PE=2 SV=1 1 313 4.0E-85
sp|Q9V9U4|DOHH_DROME Deoxyhypusine hydroxylase OS=Drosophila melanogaster GN=nero PE=2 SV=1 1 313 2.0E-80
sp|Q66KT3|DOHH_XENLA Deoxyhypusine hydroxylase OS=Xenopus laevis GN=dohh PE=2 SV=1 6 313 5.0E-79
sp|Q297S2|DOHH_DROPS Deoxyhypusine hydroxylase OS=Drosophila pseudoobscura pseudoobscura GN=nero PE=3 SV=1 1 313 1.0E-78
sp|Q5ZIP3|DOHH_CHICK Deoxyhypusine hydroxylase OS=Gallus gallus GN=DOHH PE=2 SV=1 1 313 6.0E-78
sp|Q752Z8|DOHH_ASHGO Deoxyhypusine hydroxylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LIA1 PE=3 SV=3 5 313 2.0E-76
sp|Q99LN9|DOHH_MOUSE Deoxyhypusine hydroxylase OS=Mus musculus GN=Dohh PE=1 SV=2 1 313 4.0E-74
sp|Q5PPJ4|DOHH_RAT Deoxyhypusine hydroxylase OS=Rattus norvegicus GN=Dohh PE=2 SV=1 1 313 1.0E-73
sp|Q96WP5|DOHH_LENED Deoxyhypusine hydroxylase OS=Lentinula edodes GN=LIA1 PE=2 SV=1 23 313 2.0E-73
sp|Q0VC53|DOHH_BOVIN Deoxyhypusine hydroxylase OS=Bos taurus GN=DOHH PE=1 SV=1 1 313 6.0E-73
sp|Q4PHU4|DOHH_USTMA Deoxyhypusine hydroxylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LIA1 PE=3 SV=1 6 304 7.0E-71
sp|Q9BU89|DOHH_HUMAN Deoxyhypusine hydroxylase OS=Homo sapiens GN=DOHH PE=1 SV=1 1 313 1.0E-70
sp|Q17949|DOHH_CAEEL Deoxyhypusine hydroxylase OS=Caenorhabditis elegans GN=dohh-1 PE=3 SV=1 6 315 7.0E-70
sp|Q556G4|DOHH_DICDI Deoxyhypusine hydroxylase OS=Dictyostelium discoideum GN=dohh-1 PE=3 SV=1 1 313 2.0E-68
sp|P0CN10|DOHH_CRYNJ Deoxyhypusine hydroxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LIA1 PE=3 SV=1 18 309 4.0E-64
sp|P0CN11|DOHH_CRYNB Deoxyhypusine hydroxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LIA1 PE=3 SV=1 18 309 4.0E-64
sp|Q94JW0|DOHH_ARATH Deoxyhypusine hydroxylase OS=Arabidopsis thaliana GN=At3g58180 PE=1 SV=1 2 310 1.0E-52
sp|Q8SV71|DOHH_ENCCU Deoxyhypusine hydroxylase OS=Encephalitozoon cuniculi (strain GB-M1) GN=LIA1 PE=3 SV=1 6 313 6.0E-52
sp|Q2QLW3|DOHH2_ORYSJ Deoxyhypusine hydroxylase-B OS=Oryza sativa subsp. japonica GN=Os12g0626100 PE=2 SV=1 19 317 1.0E-51
sp|D9IFD5|DOHH_LEIDO Deoxyhypusine hydroxylase OS=Leishmania donovani GN=DOHH PE=1 SV=1 1 304 4.0E-51
sp|Q2QXB3|DOHH1_ORYSJ Deoxyhypusine hydroxylase-A OS=Oryza sativa subsp. japonica GN=Os12g0163300 PE=2 SV=1 19 310 3.0E-50
sp|A5JZ19|DOHH_PLAVS Deoxyhypusine hydroxylase OS=Plasmodium vivax (strain Salvador I) GN=dohh PE=1 SV=1 23 300 5.0E-44
sp|Q2QXB3|DOHH1_ORYSJ Deoxyhypusine hydroxylase-A OS=Oryza sativa subsp. japonica GN=Os12g0163300 PE=2 SV=1 5 143 1.0E-23
sp|Q2QLW3|DOHH2_ORYSJ Deoxyhypusine hydroxylase-B OS=Oryza sativa subsp. japonica GN=Os12g0626100 PE=2 SV=1 6 143 5.0E-23
sp|Q96WP5|DOHH_LENED Deoxyhypusine hydroxylase OS=Lentinula edodes GN=LIA1 PE=2 SV=1 1 145 4.0E-22
sp|Q0UHL8|DOHH_PHANO Deoxyhypusine hydroxylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIA1 PE=3 SV=1 5 145 9.0E-22
sp|Q0UHL8|DOHH_PHANO Deoxyhypusine hydroxylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=LIA1 PE=3 SV=1 167 307 1.0E-21
sp|Q5AW32|DOHH_EMENI Deoxyhypusine hydroxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lia1 PE=3 SV=1 168 307 2.0E-21
sp|Q1E9L2|DOHH_COCIM Deoxyhypusine hydroxylase OS=Coccidioides immitis (strain RS) GN=LIA1 PE=3 SV=1 167 311 3.0E-21
sp|P0CN11|DOHH_CRYNB Deoxyhypusine hydroxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=LIA1 PE=3 SV=1 6 148 2.0E-20
sp|P0CN10|DOHH_CRYNJ Deoxyhypusine hydroxylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=LIA1 PE=3 SV=1 6 148 3.0E-20
sp|Q4HZ35|DOHH_GIBZE Deoxyhypusine hydroxylase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=LIA1 PE=3 SV=1 168 311 6.0E-20
sp|Q9P6K9|DOHH_SCHPO Deoxyhypusine hydroxylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lia1 PE=3 SV=1 164 309 3.0E-19
sp|Q17949|DOHH_CAEEL Deoxyhypusine hydroxylase OS=Caenorhabditis elegans GN=dohh-1 PE=3 SV=1 168 310 4.0E-18
sp|Q2QXB3|DOHH1_ORYSJ Deoxyhypusine hydroxylase-A OS=Oryza sativa subsp. japonica GN=Os12g0163300 PE=2 SV=1 164 308 1.0E-16
sp|Q94JW0|DOHH_ARATH Deoxyhypusine hydroxylase OS=Arabidopsis thaliana GN=At3g58180 PE=1 SV=1 175 311 1.0E-14
sp|Q2QLW3|DOHH2_ORYSJ Deoxyhypusine hydroxylase-B OS=Oryza sativa subsp. japonica GN=Os12g0626100 PE=2 SV=1 178 307 2.0E-13
sp|Q4PHU4|DOHH_USTMA Deoxyhypusine hydroxylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=LIA1 PE=3 SV=1 23 142 2.0E-13
sp|A5JZ19|DOHH_PLAVS Deoxyhypusine hydroxylase OS=Plasmodium vivax (strain Salvador I) GN=dohh PE=1 SV=1 5 138 8.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4408
MTNDTIKSLRKSLCSEETPLPVRFRALFSLKHLATGNKDNAVAVAAIEAIAAAFGSPSALLKHELAYCLGQTNNT
AAVKPLREVLSDLNEDPMCRHEAAEALGALGKTDNLDVLKHFRDREGEDVVITETCEIAIDRIEWENSKERLQEK
LRQSDFASIDPAPPMPQSEKTVDDLEKQLMDPTLPLFMRYRAMFALRDLASPPDSPTAIPAVLALAKGFDDESAL
FRHEIAFVFGQLSHPASIPALTAALSNVNEASMVRHEAAEALGSLGEEEGVEDILKSFLGDKEKVVRESVIVALD
MAEYERGADTEYALIPEVASASA*
Coding >OphauG2|4408
ATGACCAACGACACGATAAAGAGCCTAAGGAAGAGCCTTTGCTCTGAGGAAACACCTCTCCCAGTCCGATTCCGT
GCTCTCTTTTCTCTCAAGCATCTTGCAACGGGCAACAAGGACAATGCTGTGGCTGTCGCCGCAATAGAAGCCATC
GCCGCCGCCTTTGGCTCCCCCTCAGCACTACTCAAACACGAACTCGCCTACTGCCTGGGTCAAACGAACAATACT
GCGGCCGTGAAGCCATTACGAGAAGTTCTCTCCGACCTCAATGAGGATCCCATGTGTAGACACGAGGCCGCTGAG
GCCCTTGGAGCGCTTGGCAAGACGGACAACTTGGATGTGCTCAAACACTTCCGTGATCGCGAGGGCGAGGATGTT
GTCATTACTGAAACATGCGAGATTGCAATTGATAGGATAGAGTGGGAAAACTCGAAAGAGAGACTACAAGAAAAA
TTGCGGCAGAGCGACTTTGCCTCGATAGATCCTGCGCCACCGATGCCACAGTCTGAGAAGACTGTTGATGATCTG
GAGAAGCAACTCATGGACCCGACCCTGCCGCTGTTCATGCGGTATCGTGCCATGTTCGCTCTGCGAGACCTTGCG
TCACCCCCAGACAGCCCCACTGCTATTCCTGCTGTCCTTGCTTTGGCCAAAGGGTTTGACGATGAGTCGGCGCTG
TTTCGTCACGAGATCGCCTTTGTATTTGGCCAACTATCACATCCCGCGTCGATTCCGGCCCTCACCGCGGCGTTG
AGTAATGTTAACGAGGCGAGTATGGTCCGCCACGAAGCAGCCGAGGCTCTTGGTAGCTTGGGAGAAGAGGAAGGA
GTCGAGGATATCCTGAAGAGTTTTCTTGGGGACAAGGAGAAGGTGGTTCGCGAAAGCGTCATCGTGGCTTTGGAC
ATGGCCGAATACGAGAGGGGCGCCGATACTGAATATGCCTTGATTCCAGAAGTTGCAAGCGCTTCAGCGTAG
Transcript >OphauG2|4408
ATGACCAACGACACGATAAAGAGCCTAAGGAAGAGCCTTTGCTCTGAGGAAACACCTCTCCCAGTCCGATTCCGT
GCTCTCTTTTCTCTCAAGCATCTTGCAACGGGCAACAAGGACAATGCTGTGGCTGTCGCCGCAATAGAAGCCATC
GCCGCCGCCTTTGGCTCCCCCTCAGCACTACTCAAACACGAACTCGCCTACTGCCTGGGTCAAACGAACAATACT
GCGGCCGTGAAGCCATTACGAGAAGTTCTCTCCGACCTCAATGAGGATCCCATGTGTAGACACGAGGCCGCTGAG
GCCCTTGGAGCGCTTGGCAAGACGGACAACTTGGATGTGCTCAAACACTTCCGTGATCGCGAGGGCGAGGATGTT
GTCATTACTGAAACATGCGAGATTGCAATTGATAGGATAGAGTGGGAAAACTCGAAAGAGAGACTACAAGAAAAA
TTGCGGCAGAGCGACTTTGCCTCGATAGATCCTGCGCCACCGATGCCACAGTCTGAGAAGACTGTTGATGATCTG
GAGAAGCAACTCATGGACCCGACCCTGCCGCTGTTCATGCGGTATCGTGCCATGTTCGCTCTGCGAGACCTTGCG
TCACCCCCAGACAGCCCCACTGCTATTCCTGCTGTCCTTGCTTTGGCCAAAGGGTTTGACGATGAGTCGGCGCTG
TTTCGTCACGAGATCGCCTTTGTATTTGGCCAACTATCACATCCCGCGTCGATTCCGGCCCTCACCGCGGCGTTG
AGTAATGTTAACGAGGCGAGTATGGTCCGCCACGAAGCAGCCGAGGCTCTTGGTAGCTTGGGAGAAGAGGAAGGA
GTCGAGGATATCCTGAAGAGTTTTCTTGGGGACAAGGAGAAGGTGGTTCGCGAAAGCGTCATCGTGGCTTTGGAC
ATGGCCGAATACGAGAGGGGCGCCGATACTGAATATGCCTTGATTCCAGAAGTTGCAAGCGCTTCAGCGTAG
Gene >OphauG2|4408
ATGACCAACGACACGATAAAGAGCCTAAGGAAGAGCCTTTGCTCTGAGGAAACACCTCTCCCAGTCCGATTCCGT
GCTCTCTTTTCTCTCAAGCATCTTGCAACGGGCAACAAGGACAATGCTGTGGCTGTCGCCGCAATAGAAGCCATC
GCCGCCGCCTTTGGCTCCCCCTCAGCACTACTCAAACACGAACTCGCCTACTGCCTGGGTCAAACGAACAATACT
GCGGCCGTGAAGCCATTACGAGAAGTTCTCTCCGACCTCAATGAGGATCCCATGTGTAGACACGAGGCCGCTGAG
GCCCTTGGAGCGCTTGGCAAGACGGACAACTTGGATGTGCTCAAACACTTCCGTGATCGCGAGGGCGAGGATGTT
GTCATTACTGAAACATGCGAGATTGCAATTGATAGGATAGAGTGGGAAAACTCGAAAGAGAGACTACAAGAAAAA
TTGCGGCAGAGGTCTGGCTCTTGCCTTTCTTGTCGTCATGAATTCTAGCTGACACGTTTTAGCGACTTTGCCTCG
ATAGATCCTGCGCCACCGATGCCACAGTCTGAGAAGACTGTTGATGATCTGGAGAAGCAACTCATGGACCCGACC
CTGCCGCTGTTCATGCGGTATCGTGCCATGTTCGCTCTGCGAGACCTTGCGTCACCCCCAGACAGCCCCACTGCT
ATTCCTGCTGTCCTTGCTTTGGCCAAAGGGTTTGACGATGAGTCGGCGCTGTTTCGTCACGAGATCGCCTTTGTA
TTTGGCCAACTATCACATCCCGCGTCGATTCCGGCCCTCACCGCGGCGTTGAGTAATGTTAACGAGGCGAGTATG
GTCCGCCACGAAGCAGCCGAGGCTCTTGGTAGCTTGGGAGAAGAGGAAGGAGTCGAGGATATCCTGAAGAGTTTT
CTTGGGGACAAGGAGAAGGTGGTTCGCGAAAGCGTCATCGTGGCTTTGGACATGGCCGAATACGAGAGGGGCGCC
GATACTGAATATGCCTTGATTCCAGAAGTTGCAAGCGCTTCAGCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail