Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4407
Gene name
LocationContig_368:7156..8188
Strand-
Gene length (bp)1032
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10609 ParA NUBPL iron-transfer P-loop NTPase 3.7E-93 78 328
PF01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain 1.3E-08 82 243

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ34|NBP35_GIBZE Cytosolic Fe-S cluster assembly factor NBP35 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NBP35 PE=3 SV=1 1 343 0.0E+00
sp|Q2H317|NBP35_CHAGB Cytosolic Fe-S cluster assembly factor NBP35 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NBP35 PE=3 SV=1 7 341 6.0E-179
sp|Q7S8Z0|NBP35_NEUCR Cytosolic Fe-S cluster assembly factor nbp35 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nbp35 PE=3 SV=1 1 343 2.0E-177
sp|Q0UI56|NBP35_PHANO Cytosolic Fe-S cluster assembly factor NBP35 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NBP35 PE=3 SV=3 1 343 3.0E-175
sp|Q5BBC5|NBP35_EMENI Cytosolic Fe-S cluster assembly factor nbp35 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nbp35 PE=3 SV=1 1 341 6.0E-172
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HZ34|NBP35_GIBZE Cytosolic Fe-S cluster assembly factor NBP35 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NBP35 PE=3 SV=1 1 343 0.0E+00
sp|Q2H317|NBP35_CHAGB Cytosolic Fe-S cluster assembly factor NBP35 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NBP35 PE=3 SV=1 7 341 6.0E-179
sp|Q7S8Z0|NBP35_NEUCR Cytosolic Fe-S cluster assembly factor nbp35 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nbp35 PE=3 SV=1 1 343 2.0E-177
sp|Q0UI56|NBP35_PHANO Cytosolic Fe-S cluster assembly factor NBP35 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NBP35 PE=3 SV=3 1 343 3.0E-175
sp|Q5BBC5|NBP35_EMENI Cytosolic Fe-S cluster assembly factor nbp35 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nbp35 PE=3 SV=1 1 341 6.0E-172
sp|A1C7T4|NBP35_ASPCL Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nbp35 PE=3 SV=1 1 343 2.0E-169
sp|Q1EAU8|NBP35_COCIM Cytosolic Fe-S cluster assembly factor NBP35 OS=Coccidioides immitis (strain RS) GN=NBP35 PE=3 SV=1 1 341 5.0E-169
sp|Q4WZS2|NBP35_ASPFU Cytosolic Fe-S cluster assembly factor nbp35 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nbp35 PE=3 SV=1 1 343 1.0E-168
sp|Q2UDE2|NBP35_ASPOR Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nbp35 PE=3 SV=1 23 343 9.0E-167
sp|Q0CVD6|NBP35_ASPTN Cytosolic Fe-S cluster assembly factor nbp35 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nbp35 PE=3 SV=1 1 322 9.0E-167
sp|Q6C7A6|NBP35_YARLI Cytosolic Fe-S cluster assembly factor NBP35 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NBP35 PE=3 SV=1 3 333 4.0E-151
sp|Q59MP1|NBP35_CANAL Cytosolic Fe-S cluster assembly factor NBP35 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NBP35 PE=3 SV=2 19 337 3.0E-149
sp|Q6BTZ6|NBP35_DEBHA Cytosolic Fe-S cluster assembly factor NBP35 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NBP35 PE=3 SV=1 28 337 1.0E-146
sp|Q754X6|NBP35_ASHGO Cytosolic Fe-S cluster assembly factor NBP35 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NBP35 PE=3 SV=3 28 333 3.0E-142
sp|P52920|NBP35_YEAST Cytosolic Fe-S cluster assembly factor NBP35 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NBP35 PE=1 SV=1 20 333 2.0E-141
sp|P0CO88|NBP35_CRYNJ Cytosolic Fe-S cluster assembly factor NBP35 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NBP35 PE=3 SV=1 28 332 3.0E-141
sp|P0CO89|NBP35_CRYNB Cytosolic Fe-S cluster assembly factor NBP35 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NBP35 PE=3 SV=1 28 332 3.0E-141
sp|Q6CMN0|NBP35_KLULA Cytosolic Fe-S cluster assembly factor NBP35 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NBP35 PE=3 SV=1 23 333 5.0E-141
sp|Q6P298|NUBP1_DANRE Cytosolic Fe-S cluster assembly factor nubp1 OS=Danio rerio GN=nubp1 PE=2 SV=2 28 330 8.0E-141
sp|Q874M2|NBP35_CANGA Cytosolic Fe-S cluster assembly factor NBP35 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NBP35 PE=3 SV=1 4 333 1.0E-140
sp|A7RUD5|NUBP1_NEMVE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Nematostella vectensis GN=v1g236650 PE=3 SV=1 28 329 1.0E-138
sp|Q3KQF0|NUP1A_XENLA Cytosolic Fe-S cluster assembly factor nubp1-A OS=Xenopus laevis GN=nubp1-A PE=2 SV=1 28 330 4.0E-137
sp|Q5I050|NUP1B_XENLA Cytosolic Fe-S cluster assembly factor nubp1-B OS=Xenopus laevis GN=nubp1-B PE=2 SV=1 28 330 2.0E-136
sp|Q5EB25|NUBP1_XENTR Cytosolic Fe-S cluster assembly factor nubp1 OS=Xenopus tropicalis GN=nubp1 PE=2 SV=1 28 330 6.0E-136
sp|P53384|NUBP1_HUMAN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Homo sapiens GN=NUBP1 PE=1 SV=2 28 328 2.0E-133
sp|Q9R060|NUBP1_MOUSE Cytosolic Fe-S cluster assembly factor NUBP1 OS=Mus musculus GN=Nubp1 PE=1 SV=1 28 330 5.0E-133
sp|O94442|NBP35_SCHPO Cytosolic Fe-S cluster assembly factor nbp35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nbp35 PE=3 SV=1 28 317 1.0E-132
sp|Q5I0L4|NUBP1_RAT Cytosolic Fe-S cluster assembly factor NUBP1 OS=Rattus norvegicus GN=Nubp1 PE=1 SV=1 28 328 4.0E-132
sp|Q24K00|NUBP1_BOVIN Cytosolic Fe-S cluster assembly factor NUBP1 OS=Bos taurus GN=NUBP1 PE=2 SV=1 28 328 8.0E-132
sp|Q8T2F3|NUBP1_DICDI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Dictyostelium discoideum GN=nubp1 PE=3 SV=1 22 328 3.0E-130
sp|Q16T79|NUBP1_AEDAE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Aedes aegypti GN=AAEL010360 PE=3 SV=2 25 330 4.0E-122
sp|B0X4N8|NUBP1_CULQU Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Culex quinquefasciatus GN=CPIJ014142 PE=3 SV=1 25 328 1.0E-117
sp|Q7PV10|NUBP1_ANOGA Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Anopheles gambiae GN=AGAP011997 PE=3 SV=3 28 333 2.0E-117
sp|A8PW87|NUBP1_BRUMA Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Brugia malayi GN=Bm1_36105 PE=3 SV=1 29 328 1.0E-116
sp|Q93459|NUBP1_CAEEL Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis elegans GN=nubp-1 PE=2 SV=2 31 332 3.0E-113
sp|A8WWQ7|NUBP1_CAEBR Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Caenorhabditis briggsae GN=Cbr-nubp-1 PE=3 SV=1 31 332 5.0E-113
sp|Q8H1Q2|NBP35_ARATH Cytosolic Fe-S cluster assembly factor NBP35 OS=Arabidopsis thaliana GN=NBP35 PE=1 SV=1 29 329 1.0E-112
sp|B4JBI7|NUBP1_DROGR Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila grimshawi GN=GH11560 PE=3 SV=1 23 306 3.0E-107
sp|B4N1C3|NUBP1_DROWI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila willistoni GN=GK24826 PE=3 SV=1 28 333 1.0E-106
sp|Q29MT7|NUBP1_DROPS Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA14715 PE=3 SV=1 23 332 2.0E-106
sp|B4G8R5|NUBP1_DROPE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila persimilis GN=GL18780 PE=3 SV=1 23 332 2.0E-106
sp|B3NNJ9|NUBP1_DROER Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila erecta GN=GG22765 PE=3 SV=1 23 306 1.0E-104
sp|Q9VJI9|NUBP1_DROME Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila melanogaster GN=CG17904 PE=2 SV=1 23 306 3.0E-104
sp|B4LUF5|NUBP1_DROVI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila virilis GN=GJ17301 PE=3 SV=1 23 306 4.0E-104
sp|B4I540|NUBP1_DROSE Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila sechellia GN=GM17199 PE=3 SV=1 23 306 4.0E-104
sp|B4Q7F5|NUBP1_DROSI Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila simulans GN=GD24076 PE=3 SV=1 23 306 6.0E-104
sp|B4P9A8|NUBP1_DROYA Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila yakuba GN=GE12759 PE=3 SV=1 23 306 7.0E-104
sp|B3MU92|NUBP1_DROAN Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila ananassae GN=GF20875 PE=3 SV=1 28 306 5.0E-102
sp|B4KHX1|NUBP1_DROMO Cytosolic Fe-S cluster assembly factor NUBP1 homolog OS=Drosophila mojavensis GN=GI17051 PE=3 SV=1 23 306 3.0E-100
sp|A7SE07|NUBP2_NEMVE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Nematostella vectensis GN=v1g229988 PE=3 SV=1 75 328 8.0E-89
sp|Q76NZ7|NUBP2_DICDI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Dictyostelium discoideum GN=nubp2 PE=3 SV=1 78 328 1.0E-88
sp|Q3MHY6|NUBP2_BOVIN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Bos taurus GN=NUBP2 PE=2 SV=1 67 331 6.0E-87
sp|Q5ZKV4|NUBP2_CHICK Cytosolic Fe-S cluster assembly factor NUBP2 OS=Gallus gallus GN=NUBP2 PE=2 SV=1 67 330 2.0E-86
sp|Q9Y5Y2|NUBP2_HUMAN Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens GN=NUBP2 PE=1 SV=1 67 330 5.0E-85
sp|A9V7A1|NUBP2_MONBE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Monosiga brevicollis GN=33756 PE=3 SV=1 64 334 3.0E-84
sp|B3RPX4|NUBP2_TRIAD Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_53697 PE=3 SV=1 78 329 3.0E-83
sp|Q68FS1|NUBP2_RAT Cytosolic Fe-S cluster assembly factor NUBP2 OS=Rattus norvegicus GN=Nubp2 PE=1 SV=1 67 332 4.0E-83
sp|Q6DEE4|NUBP2_XENLA Cytosolic Fe-S cluster assembly factor nubp2 OS=Xenopus laevis GN=nubp2 PE=2 SV=1 74 330 5.0E-83
sp|A4QNM5|NUBP2_XENTR Cytosolic Fe-S cluster assembly factor nubp2 OS=Xenopus tropicalis GN=nubp2 PE=2 SV=2 74 330 9.0E-83
sp|Q7QGS3|NUBP2_ANOGA Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Anopheles gambiae GN=AGAP010873 PE=3 SV=4 78 328 2.0E-82
sp|Q3B7Q7|NUBP2_DANRE Cytosolic Fe-S cluster assembly factor nubp2 OS=Danio rerio GN=nubp2 PE=2 SV=1 78 333 2.0E-82
sp|Q9R061|NUBP2_MOUSE Cytosolic Fe-S cluster assembly factor NUBP2 OS=Mus musculus GN=Nubp2 PE=1 SV=1 56 332 1.0E-80
sp|Q16H50|NUBP2_AEDAE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Aedes aegypti GN=AAEL008143 PE=3 SV=1 75 328 7.0E-80
sp|B4QJ46|NUBP2_DROSI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila simulans GN=GD14899 PE=3 SV=1 78 332 1.0E-79
sp|B4IAD1|NUBP2_DROSE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila sechellia GN=GM22307 PE=3 SV=1 78 332 2.0E-79
sp|B0XDJ0|NUBP2_CULQU Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Culex quinquefasciatus GN=CPIJ017390 PE=3 SV=1 78 328 3.0E-79
sp|B3NIP2|NUBP2_DROER Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila erecta GN=GG16127 PE=3 SV=1 78 328 5.0E-79
sp|Q9VPD2|NUBP2_DROME Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila melanogaster GN=CG4858 PE=2 SV=1 78 332 7.0E-79
sp|P40558|CFD1_YEAST Cytosolic Fe-S cluster assembly factor CFD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CFD1 PE=1 SV=1 65 331 7.0E-79
sp|B4IUH5|NBP21_DROYA Cytosolic Fe-S cluster assembly factor NUBP2 homolog 1 OS=Drosophila yakuba GN=GE23241 PE=3 SV=1 78 328 1.0E-78
sp|B4PES4|NBP22_DROYA Cytosolic Fe-S cluster assembly factor NUBP2 homolog 2 OS=Drosophila yakuba GN=GE19695 PE=3 SV=1 78 328 4.0E-78
sp|Q29DB7|NUBP2_DROPS Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA18483 PE=3 SV=2 78 329 7.0E-78
sp|B3M9R3|NUBP2_DROAN Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila ananassae GN=GF10354 PE=3 SV=1 78 326 5.0E-77
sp|B4IYG8|NUBP2_DROGR Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila grimshawi GN=GH14587 PE=3 SV=1 78 326 1.0E-76
sp|B4N4D9|NUBP2_DROWI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila willistoni GN=GK12055 PE=3 SV=1 78 326 4.0E-76
sp|Q6C5D0|CFD1_YARLI Cytosolic Fe-S cluster assembly factor CFD1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CFD1 PE=3 SV=1 75 298 1.0E-75
sp|B4LGB4|NUBP2_DROVI Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila virilis GN=GJ11530 PE=3 SV=1 78 326 2.0E-75
sp|B4KY56|NUBP2_DROMO Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila mojavensis GN=GI13405 PE=3 SV=1 78 326 2.0E-75
sp|Q6CQV4|CFD1_KLULA Cytosolic Fe-S cluster assembly factor CFD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CFD1 PE=3 SV=1 65 330 5.0E-75
sp|Q57731|APBC_METJA Iron-sulfur cluster carrier protein OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0283 PE=3 SV=1 44 337 6.0E-75
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 77 332 1.0E-74
sp|Q75AC3|CFD1_ASHGO Cytosolic Fe-S cluster assembly factor CFD1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CFD1 PE=3 SV=2 78 331 7.0E-74
sp|B4H7P4|NUBP2_DROPE Cytosolic Fe-S cluster assembly factor NUBP2 homolog OS=Drosophila persimilis GN=GL12799 PE=3 SV=1 78 329 1.0E-73
sp|Q6FPP7|CFD1_CANGA Cytosolic Fe-S cluster assembly factor CFD1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CFD1 PE=3 SV=1 72 298 1.0E-72
sp|Q4I174|CFD1_GIBZE Cytosolic Fe-S cluster assembly factor CFD1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CFD1 PE=3 SV=2 75 306 2.0E-72
sp|Q59YD9|CFD1_CANAL Cytosolic Fe-S cluster assembly factor CFD1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CFD1 PE=3 SV=1 78 298 3.0E-72
sp|Q2GWZ4|CFD1_CHAGB Cytosolic Fe-S cluster assembly factor CFD1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CFD1 PE=3 SV=1 75 307 1.0E-70
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 78 315 2.0E-70
sp|Q6BWQ9|CFD1_DEBHA Cytosolic Fe-S cluster assembly factor CFD1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CFD1 PE=3 SV=2 75 296 1.0E-69
sp|Q8X0F1|CFD1_NEUCR Cytosolic Fe-S cluster assembly factor cfd1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cfd1 PE=3 SV=1 75 306 1.0E-68
sp|Q0UAM9|CFD1_PHANO Cytosolic Fe-S cluster assembly factor CFD1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CFD1 PE=3 SV=1 75 305 8.0E-66
sp|Q6LZC5|APBC_METMP Iron-sulfur cluster carrier protein OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP0704 PE=1 SV=1 69 332 2.0E-63
sp|Q4P8S7|CFD1_USTMA Cytosolic Fe-S cluster assembly factor CFD1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CFD1 PE=3 SV=1 71 303 2.0E-63
sp|Q0CE30|CFD1_ASPTN Cytosolic Fe-S cluster assembly factor cfd1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cfd1 PE=3 SV=1 75 298 4.0E-63
sp|Q2UA27|CFD1_ASPOR Cytosolic Fe-S cluster assembly factor cfd1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cfd1 PE=3 SV=1 75 295 6.0E-62
sp|P0CO90|CFD1_CRYNJ Cytosolic Fe-S cluster assembly factor CFD1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CFD1 PE=3 SV=1 71 295 1.0E-61
sp|P0CO91|CFD1_CRYNB Cytosolic Fe-S cluster assembly factor CFD1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CFD1 PE=3 SV=1 71 295 1.0E-61
sp|A1C4X8|CFD1_ASPCL Cytosolic Fe-S cluster assembly factor cfd1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cfd1 PE=3 SV=1 75 298 3.0E-61
sp|Q4WEN1|CFD1_ASPFU Cytosolic Fe-S cluster assembly factor cfd1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cfd1 PE=3 SV=1 75 295 1.0E-60
sp|Q97ZW4|APBC_SULSO Iron-sulfur cluster carrier protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0460 PE=3 SV=1 71 329 1.0E-58
sp|Q1DSY6|CFD1_COCIM Cytosolic Fe-S cluster assembly factor CFD1 OS=Coccidioides immitis (strain RS) GN=CFD1 PE=3 SV=1 75 295 1.0E-58
sp|P0C8Q1|CFD1_EMENI Cytosolic Fe-S cluster assembly factor cfd1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cfd1 PE=3 SV=1 75 295 4.0E-58
sp|O58667|APBC_PYRHO Iron-sulfur cluster carrier protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0949 PE=3 SV=1 82 332 2.0E-56
sp|Q9V0D9|APBC_PYRAB Iron-sulfur cluster carrier protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB08510 PE=3 SV=1 82 332 3.0E-55
sp|Q8U1R0|APBC_PYRFU Iron-sulfur cluster carrier protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1145 PE=3 SV=1 82 332 3.0E-53
sp|Q54F15|NUBPL_DICDI Iron-sulfur protein NUBPL OS=Dictyostelium discoideum GN=nubpl PE=3 SV=1 50 334 6.0E-53
sp|Q8TB37|NUBPL_HUMAN Iron-sulfur protein NUBPL OS=Homo sapiens GN=NUBPL PE=1 SV=3 77 332 3.0E-52
sp|Q9CWD8|NUBPL_MOUSE Iron-sulfur protein NUBPL OS=Mus musculus GN=Nubpl PE=1 SV=2 77 332 5.0E-51
sp|Q9ZMM5|APBC_HELPJ Iron-sulfur cluster carrier protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=mrp PE=3 SV=1 77 328 3.0E-50
sp|O24999|APBC_HELPY Iron-sulfur cluster carrier protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=mrp PE=3 SV=2 77 328 8.0E-50
sp|O66946|APBC_AQUAE Iron-sulfur cluster carrier protein OS=Aquifex aeolicus (strain VF5) GN=mrp PE=3 SV=1 77 328 8.0E-47
sp|P53383|APBC_SYNY3 Iron-sulfur cluster carrier protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mrp PE=3 SV=1 78 328 2.0E-46
sp|P45135|APBC_HAEIN Iron-sulfur cluster carrier protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mrp PE=3 SV=2 77 332 3.0E-46
sp|Q9RVM9|APBC_DEIRA Iron-sulfur cluster carrier protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mrp PE=3 SV=1 69 341 1.0E-45
sp|P0AF08|APBC_ECOLI Iron-sulfur cluster carrier protein OS=Escherichia coli (strain K12) GN=mrp PE=3 SV=1 77 337 2.0E-45
sp|P0AF09|APBC_ECOL6 Iron-sulfur cluster carrier protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mrp PE=3 SV=1 77 337 2.0E-45
sp|Q8ZNN5|APBC_SALTY Iron-sulfur cluster carrier protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=apbC PE=1 SV=1 77 337 3.0E-45
sp|Q6CE48|IND1_YARLI Iron-sulfur protein IND1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IND1 PE=1 SV=1 75 305 6.0E-45
sp|P53381|APBC_CLOPE Iron-sulfur cluster carrier protein OS=Clostridium perfringens (strain 13 / Type A) GN=mrp PE=3 SV=2 44 313 2.0E-44
sp|Q4UKB5|APBC_RICFE Iron-sulfur cluster carrier protein OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mrp PE=3 SV=1 77 303 1.0E-43
sp|Q68XP6|APBC_RICTY Iron-sulfur cluster carrier protein OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mrp PE=3 SV=1 77 303 1.0E-43
sp|Q1RHB0|APBC_RICBR Iron-sulfur cluster carrier protein OS=Rickettsia bellii (strain RML369-C) GN=mrp PE=3 SV=1 77 303 2.0E-43
sp|Q92JA4|APBC_RICCN Iron-sulfur cluster carrier protein OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mrp PE=3 SV=1 77 303 3.0E-42
sp|P72190|APBC_PSEFR Iron-sulfur cluster carrier protein OS=Pseudomonas fragi PE=3 SV=1 75 327 5.0E-42
sp|Q9ZE27|APBC_RICPR Iron-sulfur cluster carrier protein OS=Rickettsia prowazekii (strain Madrid E) GN=mrp PE=3 SV=1 77 303 2.0E-41
sp|Q0JJS8|HF101_ORYSJ Fe-S cluster assembly factor HCF101, chloroplastic OS=Oryza sativa subsp. japonica GN=HCF101 PE=3 SV=3 75 331 1.0E-34
sp|Q6STH5|HF101_ARATH Fe-S cluster assembly factor HCF101, chloroplastic OS=Arabidopsis thaliana GN=HCF101 PE=1 SV=1 75 331 1.0E-33
sp|P53382|APBC_MYCLE Iron-sulfur cluster carrier protein OS=Mycobacterium leprae (strain TN) GN=mrp PE=3 SV=2 84 316 2.0E-33
sp|P50863|APBC_BACSU Iron-sulfur cluster carrier protein OS=Bacillus subtilis (strain 168) GN=salA PE=2 SV=1 84 336 2.0E-29
sp|P9WJN7|APBC_MYCTU Iron-sulfur cluster carrier protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mrp PE=1 SV=1 84 315 5.0E-28
sp|P9WJN6|APBC_MYCTO Iron-sulfur cluster carrier protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mrp PE=3 SV=1 84 315 5.0E-28
sp|P65442|APBC_MYCBO Iron-sulfur cluster carrier protein OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mrp PE=3 SV=1 84 315 5.0E-28
sp|Q57967|Y547_METJA Uncharacterized ATP-binding protein MJ0547 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0547 PE=4 SV=1 82 340 1.0E-16
sp|P56346|MIND_CHLVU Putative septum site-determining protein MinD OS=Chlorella vulgaris GN=minD PE=3 SV=1 77 306 2.0E-09
sp|Q01464|MIND_BACSU Septum site-determining protein MinD OS=Bacillus subtilis (strain 168) GN=minD PE=1 SV=1 82 329 8.0E-09
sp|Q20EV4|MIND_OLTVI Putative septum site-determining protein MinD OS=Oltmannsiellopsis viridis GN=minD PE=3 SV=1 75 306 3.0E-08
sp|Q9MUM5|MIND_MESVI Putative septum site-determining protein MinD OS=Mesostigma viride GN=minD PE=3 SV=1 80 306 7.0E-08
sp|Q9T3P6|MIND_NEPOL Putative septum site-determining protein MinD OS=Nephroselmis olivacea GN=minD-A PE=3 SV=1 82 329 2.0E-07
sp|O78436|MIND_GUITH Putative septum site-determining protein MinD OS=Guillardia theta GN=minD PE=3 SV=1 82 306 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6336
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4407 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1209
Ophiocordyceps camponoti-floridani Ophcf2|02801
Ophiocordyceps camponoti-rufipedis Ophun1|4564
Ophiocordyceps kimflemingae Ophio5|3712

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4407
MAPLLGEPIADVLASPIGQKAQLVAPEPEHCPGPESQQAGQADSCAGCPNQAICASGAGRSSEPDADVAAVAARL
VGVRHKILVLSGKGGVGKSTFTALLGHALAADPGRAVGIMDADVCGPSIPKMMGVEEETIHMSGSGLEPVWVLDN
LGVMSIQFMLPGRDDAVIWRGPKKNGLIKRFLKDVDWGEIDFLLVDTPPGTSDEHLSVNALLQDSGIDGAVLVTT
PQEVALLDVRKEIDFCRKAGIPIIGLAENMSTFVCPHCKGESTIFRPSTGGARGLAAEMGIPFLGAVPLDPRIRM
ACDYGESYFDSFPDSPACAAFQALVQTIVDQLGIKTEAKMPSD*
Coding >OphauG2|4407
ATGGCACCGTTGCTCGGAGAGCCCATTGCCGATGTCTTAGCCAGCCCGATAGGACAAAAAGCGCAGCTCGTGGCG
CCGGAGCCTGAGCACTGTCCAGGCCCTGAGTCACAGCAAGCAGGCCAAGCCGATTCATGCGCTGGATGCCCGAAC
CAGGCGATTTGCGCGTCGGGTGCAGGACGCAGCAGCGAGCCAGATGCAGACGTGGCAGCAGTGGCAGCGCGACTG
GTGGGTGTGCGGCACAAGATACTGGTGTTGAGTGGCAAGGGAGGCGTGGGCAAGAGCACCTTTACCGCATTACTG
GGCCATGCGCTGGCGGCGGACCCGGGCCGAGCTGTTGGAATCATGGATGCCGACGTGTGTGGACCGAGCATCCCC
AAGATGATGGGCGTCGAGGAGGAGACGATACACATGAGCGGGTCTGGCCTGGAGCCCGTATGGGTGCTTGACAAC
CTGGGGGTCATGAGCATTCAGTTTATGCTTCCGGGCCGCGACGATGCCGTGATATGGCGCGGGCCAAAAAAGAAC
GGTCTGATCAAGCGGTTTCTCAAGGATGTCGACTGGGGCGAAATCGACTTTCTCCTTGTTGACACGCCGCCGGGT
ACCAGCGACGAACACTTGAGCGTCAATGCACTTCTGCAGGACAGTGGTATCGACGGAGCGGTCCTTGTCACGACG
CCCCAGGAAGTGGCTTTACTCGATGTGCGCAAGGAAATTGACTTTTGCCGCAAGGCCGGCATCCCCATCATCGGA
CTGGCTGAGAACATGAGCACATTTGTCTGCCCGCACTGCAAGGGCGAGAGCACCATCTTCCGGCCCAGCACGGGC
GGCGCTCGCGGGTTGGCGGCCGAAATGGGCATTCCCTTTCTCGGTGCTGTGCCACTGGATCCCAGGATTCGCATG
GCGTGCGACTACGGAGAGAGTTACTTTGACTCGTTTCCCGACAGCCCTGCCTGTGCCGCCTTTCAGGCCTTGGTG
CAGACCATTGTGGACCAGCTGGGCATCAAAACGGAAGCAAAAATGCCGTCTGACTGA
Transcript >OphauG2|4407
ATGGCACCGTTGCTCGGAGAGCCCATTGCCGATGTCTTAGCCAGCCCGATAGGACAAAAAGCGCAGCTCGTGGCG
CCGGAGCCTGAGCACTGTCCAGGCCCTGAGTCACAGCAAGCAGGCCAAGCCGATTCATGCGCTGGATGCCCGAAC
CAGGCGATTTGCGCGTCGGGTGCAGGACGCAGCAGCGAGCCAGATGCAGACGTGGCAGCAGTGGCAGCGCGACTG
GTGGGTGTGCGGCACAAGATACTGGTGTTGAGTGGCAAGGGAGGCGTGGGCAAGAGCACCTTTACCGCATTACTG
GGCCATGCGCTGGCGGCGGACCCGGGCCGAGCTGTTGGAATCATGGATGCCGACGTGTGTGGACCGAGCATCCCC
AAGATGATGGGCGTCGAGGAGGAGACGATACACATGAGCGGGTCTGGCCTGGAGCCCGTATGGGTGCTTGACAAC
CTGGGGGTCATGAGCATTCAGTTTATGCTTCCGGGCCGCGACGATGCCGTGATATGGCGCGGGCCAAAAAAGAAC
GGTCTGATCAAGCGGTTTCTCAAGGATGTCGACTGGGGCGAAATCGACTTTCTCCTTGTTGACACGCCGCCGGGT
ACCAGCGACGAACACTTGAGCGTCAATGCACTTCTGCAGGACAGTGGTATCGACGGAGCGGTCCTTGTCACGACG
CCCCAGGAAGTGGCTTTACTCGATGTGCGCAAGGAAATTGACTTTTGCCGCAAGGCCGGCATCCCCATCATCGGA
CTGGCTGAGAACATGAGCACATTTGTCTGCCCGCACTGCAAGGGCGAGAGCACCATCTTCCGGCCCAGCACGGGC
GGCGCTCGCGGGTTGGCGGCCGAAATGGGCATTCCCTTTCTCGGTGCTGTGCCACTGGATCCCAGGATTCGCATG
GCGTGCGACTACGGAGAGAGTTACTTTGACTCGTTTCCCGACAGCCCTGCCTGTGCCGCCTTTCAGGCCTTGGTG
CAGACCATTGTGGACCAGCTGGGCATCAAAACGGAAGCAAAAATGCCGTCTGACTGA
Gene >OphauG2|4407
ATGGCACCGTTGCTCGGAGAGCCCATTGCCGATGTCTTAGCCAGCCCGATAGGACAAAAAGCGCAGCTCGTGGCG
CCGGAGCCTGAGCACTGTCCAGGCCCTGAGTCACAGCAAGCAGGCCAAGCCGATTCATGCGCTGGATGCCCGAAC
CAGGCGATTTGCGCGTCGGGTGCAGGACGCAGCAGCGAGCCAGATGCAGACGTGGCAGCAGTGGCAGCGCGACTG
GTGGGTGTGCGGCACAAGATACTGGTGTTGAGTGGCAAGGGAGGCGTGGGCAAGAGCACCTTTACCGCATTACTG
GGCCATGCGCTGGCGGCGGACCCGGGCCGAGCTGTTGGAATCATGGATGCCGACGTGTGTGGACCGAGCATCCCC
AAGATGATGGGCGTCGAGGAGGAGACGATACACATGAGCGGGTCTGGCCTGGAGCCCGTATGGGTGCTTGACAAC
CTGGGGGTCATGAGCATTCAGTTTATGCTTCCGGGCCGCGACGATGCCGTGATATGGCGCGGGCCAAAAAAGAAC
GGTCTGATCAAGCGGTTTCTCAAGGATGTCGACTGGGGCGAAATCGACTTTCTCCTTGTTGACACGCCGCCGGGT
ACCAGCGACGAACACTTGAGCGTCAATGCACTTCTGCAGGACAGTGGTATCGACGGAGCGGTCCTTGTCACGACG
CCCCAGGAAGTGGCTTTACTCGATGTGCGCAAGGAAATTGACTTTTGCCGCAAGGCCGGCATCCCCATCATCGGA
CTGGCTGAGAACATGAGCACATTTGTCTGCCCGCACTGCAAGGGCGAGAGCACCATCTTCCGGCCCAGCACGGGC
GGCGCTCGCGGGTTGGCGGCCGAAATGGGCATTCCCTTTCTCGGTGCTGTGCCACTGGATCCCAGGATTCGCATG
GCGTGCGACTACGGAGAGAGTTACTTTGACTCGTTTCCCGACAGCCCTGCCTGTGCCGCCTTTCAGGCCTTGGTG
CAGACCATTGTGGACCAGCTGGGCATCAAAACGGAAGCAAAAATGCCGTCTGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail