Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4406
Gene name
LocationContig_368:6450..7051
Strand+
Gene length (bp)601
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein 1.1E-19 17 134

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13808|GMF1_SCHPO Actin-depolymerizing factor gmf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmf1 PE=3 SV=1 1 132 1.0E-21
sp|Q12156|AIM7_YEAST Protein AIM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM7 PE=1 SV=1 5 141 9.0E-19
sp|Q63228|GMFB_RAT Glia maturation factor beta OS=Rattus norvegicus GN=Gmfb PE=1 SV=2 11 134 2.0E-17
sp|Q5R6P6|GMFB_PONAB Glia maturation factor beta OS=Pongo abelii GN=GMFB PE=2 SV=3 11 134 4.0E-17
sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens GN=GMFB PE=1 SV=2 11 134 4.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13808|GMF1_SCHPO Actin-depolymerizing factor gmf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gmf1 PE=3 SV=1 1 132 1.0E-21
sp|Q12156|AIM7_YEAST Protein AIM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM7 PE=1 SV=1 5 141 9.0E-19
sp|Q63228|GMFB_RAT Glia maturation factor beta OS=Rattus norvegicus GN=Gmfb PE=1 SV=2 11 134 2.0E-17
sp|Q5R6P6|GMFB_PONAB Glia maturation factor beta OS=Pongo abelii GN=GMFB PE=2 SV=3 11 134 4.0E-17
sp|P60983|GMFB_HUMAN Glia maturation factor beta OS=Homo sapiens GN=GMFB PE=1 SV=2 11 134 4.0E-17
sp|P60984|GMFB_BOVIN Glia maturation factor beta OS=Bos taurus GN=GMFB PE=1 SV=2 11 134 4.0E-17
sp|Q9CQI3|GMFB_MOUSE Glia maturation factor beta OS=Mus musculus GN=Gmfb PE=1 SV=3 11 134 5.0E-17
sp|Q56JZ9|GMFG_BOVIN Glia maturation factor gamma OS=Bos taurus GN=GMFG PE=2 SV=1 13 140 4.0E-16
sp|Q9ERL7|GMFG_MOUSE Glia maturation factor gamma OS=Mus musculus GN=Gmfg PE=1 SV=1 15 140 7.0E-16
sp|O60234|GMFG_HUMAN Glia maturation factor gamma OS=Homo sapiens GN=GMFG PE=1 SV=1 18 134 2.0E-15
sp|Q80T18|GMFG_RAT Glia maturation factor gamma OS=Rattus norvegicus GN=Gmfg PE=2 SV=1 15 140 4.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003779 actin binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2078
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4406 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1208
Ophiocordyceps camponoti-floridani Ophcf2|02800
Ophiocordyceps camponoti-rufipedis Ophun1|4565
Ophiocordyceps kimflemingae Ophio5|3713
Ophiocordyceps subramaniannii Hirsu2|2405

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4406
MASESRLYKFSDDTKSHLRKFRLTTSRAKEPQAVIYLIDKNTHEIRQDEDATIYRSLDDVATDLPDHAPRFVLLS
YPMTLPDGRMSVPYVLLYYLPLTCNAEVRMLYAGAKELMRNTSEVGKVLDIESPEDLQEVPHKLKQ*
Coding >OphauG2|4406
ATGGCATCAGAGTCGAGGCTATACAAGTTCTCCGACGACACAAAAAGCCACCTCCGCAAATTCCGTCTTACCACG
TCGCGAGCCAAAGAGCCCCAAGCTGTCATTTACTTGATCGATAAGAACACGCATGAAATCCGTCAGGACGAAGAC
GCCACTATCTACCGGTCCCTCGATGACGTGGCCACGGACCTGCCCGACCATGCTCCTCGTTTCGTGCTTCTAAGC
TATCCCATGACGCTGCCCGATGGCCGCATGTCTGTGCCCTATGTCCTCCTTTATTACCTTCCCTTAACTTGCAAC
GCCGAGGTGCGCATGCTGTATGCAGGCGCCAAGGAGTTGATGCGCAACACGAGCGAGGTTGGCAAGGTGCTAGAC
ATCGAGTCCCCTGAAGACTTGCAAGAGGTGCCCCACAAGTTGAAGCAGTAA
Transcript >OphauG2|4406
ATGGCATCAGAGTCGAGGCTATACAAGTTCTCCGACGACACAAAAAGCCACCTCCGCAAATTCCGTCTTACCACG
TCGCGAGCCAAAGAGCCCCAAGCTGTCATTTACTTGATCGATAAGAACACGCATGAAATCCGTCAGGACGAAGAC
GCCACTATCTACCGGTCCCTCGATGACGTGGCCACGGACCTGCCCGACCATGCTCCTCGTTTCGTGCTTCTAAGC
TATCCCATGACGCTGCCCGATGGCCGCATGTCTGTGCCCTATGTCCTCCTTTATTACCTTCCCTTAACTTGCAAC
GCCGAGGTGCGCATGCTGTATGCAGGCGCCAAGGAGTTGATGCGCAACACGAGCGAGGTTGGCAAGGTGCTAGAC
ATCGAGTCCCCTGAAGACTTGCAAGAGGTGCCCCACAAGTTGAAGCAGTAA
Gene >OphauG2|4406
ATGGTGCCTTTACAGCCTCTATCCCAGCCTTCTCCTGCTCTCTCCATGCTAACAGAGGCTTCGTTCAAGGCATCA
GAGTCGAGGCTATACAAGTTCTCCGACGACACAAAAAGCCACCTCCGCAAATTCCGTCTTACCACGTCGCGAGCC
AAAGAGCCCCAAGCTGTCATTTGTCCGTCTCTTGTCCCCTCTGCCCAAACCATGGCGCTAATCGTGCCTCTTGTC
CAGACTTGATCGATAAGAACACGCATGAAATCCGTCAGGACGAAGACGCCACTATCTACCGGTCCCTCGATGACG
TGGCCACGGACCTGCCCGACCATGCTCCTCGTTTCGTGCTTCTAAGCTATCCCATGACGCTGGTGCGCCTTATTC
CCTCTTGGCCTTGTCCAGCCAACTTACAATCAGATACTAGCCCGATGGCCGCATGTCTGTGCCCTATGTCCTCCT
TTATTACCTTCCCTTAACTTGCAACGCCGAGGTGCGCATGCTGTATGCAGGCGCCAAGGAGTTGATGCGCAACAC
GAGCGAGGTTGGCAAGGTGCTAGACATCGAGTCCCCTGAAGACTTGCAAGAGGTGCCCCACAAGTTGAAGCAGTA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail