Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4403
Gene name
LocationContig_367:12856..17283
Strand-
Gene length (bp)4427
Transcript length (bp)3882
Coding sequence length (bp)3882
Protein length (aa) 1294

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18 4.2E-31 50 361

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 92 364 3.0E-14
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 64 379 5.0E-14
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 64 364 6.0E-13
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 85 362 2.0E-12
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 28 364 6.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20533|CHIA1_BACCI Chitinase A1 OS=Bacillus circulans GN=chiA1 PE=1 SV=1 92 364 3.0E-14
sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 64 379 5.0E-14
sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 64 364 6.0E-13
sp|Q11174|CHIT_CAEEL Probable endochitinase OS=Caenorhabditis elegans GN=cht-1 PE=1 SV=1 85 362 2.0E-12
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 28 364 6.0E-10
sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 35 364 1.0E-09
sp|P32470|CHI1_APHAL Chitinase 1 OS=Aphanocladium album GN=CHI1 PE=1 SV=2 85 368 5.0E-08
sp|H2A0L4|CHI1_PINMG Putative chitinase 1 OS=Pinctada margaritifera PE=1 SV=1 35 362 8.0E-08
sp|Q9WTV1|CH3L1_RAT Chitinase-3-like protein 1 OS=Rattus norvegicus GN=Chi3l1 PE=2 SV=3 64 394 1.0E-07
sp|E9QRF2|CHIB1_ASPFU Endochitinase B1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chiB1 PE=3 SV=1 85 372 2.0E-07
sp|Q873X9|CHIB1_ASPFM Endochitinase B1 OS=Neosartorya fumigata GN=chiB1 PE=1 SV=1 85 372 2.0E-07
sp|Q5AKZ3|CHI5_CANAL Probable chitinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.12451 PE=3 SV=1 122 359 4.0E-07
sp|A6N6J0|CHI46_TRIHA Endochitinase 46 OS=Trichoderma harzianum GN=chit46 PE=1 SV=1 118 368 5.0E-07
sp|Q5AM60|CHI4_CANAL Chitinase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHT4 PE=3 SV=1 94 363 4.0E-06
sp|P48827|CHI42_TRIHA Endochitinase 42 OS=Trichoderma harzianum GN=chit42 PE=1 SV=1 118 368 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4403
MELVSSRMVLMLVLCMALTTQSARDGVKGLDFSRRIGFYDLEAAAQETGCGGIQVENLQLAPLTHLVVAHASIGT
HGRVSEKHAGLMYRASLAKLKHPSLGIVVSVKDDGGSRAWMLAATSAAKRQVLIQSMIDLVVKYGFSGVDLDWSR
IEMQPRLVQDHLHFLHELRHALDSRDARWTLSVTLTARNTWLAHFPLKGIQHHANWINLKICSSSKTQTKDDAQL
LLGAHMDMAQVTDSIRVLQHNGIDAVNVVVGMPLYGHAFLLDDRACIHPDGTCKYAATRTDSCSPEPGTLSYAQL
VAHNASQATQEFHSSAGLFKYTVLDDDTWVSYDDAQTWAAKLSLLASLGVGGIALWSLNNDNSRFDALSALVGDF
SSLQLHGPQLRADERIAVAEHLAAFTGQDCFVTARCSDGSRGQRAPEQVCPRGFLSLSTAHTPLQAPRQRLGDEC
GEQWYRHVCCPRSAMPKNCAWMGCGERCAGGKFELNSDRFKDARGREQCERARRPLCCDATPAMAGCRWTSCQGP
LAAGEKPACPRGLLYQTHRLDDPDGSGTCGAALSGLDAEQAVAGGKKEAEQDVAGGKKEAALAGSFKSALCCPDT
NAVSRCSWAASPPRPGSPCLPQPCQQGGVLLATALQPAVEPNCSIVEKTHRFNYCCEPHALAKKPPVDPANLFQK
TSSNGPDDELAWAYTENPSNNDQSHVHHSQTPPDHDAYGHDAYGFVMLDGPSGSIDNTFAHVHTIVRPRAGIGKF
KRSAVTTNRTLIDSVFDAAQETLHIYCNYPADSPECQRLWLDGARDTVIRLPHHIGLGPFARVVSIADVSHSFSL
PTHHLHHRSLQGLATPVYRLTVDYSFDQITPKRANEPVNIRIDYTNLLGYWDEMTDARPASRKRSGDARGLDWHA
RVNRAIARDRRLRKRAEPINVTVPMSHGADMVERERDVALDKRWWGAFVAWIRRLTTVKKSNVGVLPLGWKSKLN
LLRMRQGCSRQTFSASLDIDLEASIGLDMTYAYYLSGSFIPPSIPDAYAYLGMEPHAYAGIRIAGRAQMQYRSER
KQLIDTITYPGLAIKGIVSIGPTFDLYGQIIGKITVSGQLHAGAHLQVSKAEVYWPQDAAASKKYQKLLGLDSTS
HVPAHAPNPTLDAALKLDASLDISLQPQASLGIKVGGGVVTAGKTIMDAQLSGYLVGTLSFQASTDVDTSTKTMH
YSYGVYLLFNLGYSARAHILGLVDWAMAPREAFVPPKQVNVIGPVRESISWGRREAEQVDMADGDLDIGISRRGL
NASVETRELFGRSLSPPG*
Coding >OphauG2|4403
ATGGAGCTCGTCAGCAGCAGAATGGTCTTGATGCTAGTCTTGTGCATGGCTCTCACGACACAGTCAGCGCGCGAT
GGGGTCAAGGGATTAGACTTTTCCCGACGCATCGGGTTCTACGACTTGGAGGCGGCGGCGCAGGAAACCGGGTGT
GGGGGAATCCAGGTTGAAAACCTACAACTCGCGCCGCTCACGCATCTCGTTGTTGCGCACGCGTCGATTGGGACG
CACGGCAGGGTTTCGGAGAAACATGCTGGTCTCATGTACCGGGCCTCGCTGGCAAAGCTCAAGCATCCGAGTCTT
GGGATTGTCGTGTCGGTCAAGGATGATGGGGGGTCGAGGGCGTGGATGCTAGCGGCGACGTCGGCTGCAAAGAGG
CAGGTTCTGATACAGTCCATGATTGACCTTGTTGTCAAGTATGGATTCAGCGGAGTGGACCTGGATTGGTCACGG
ATTGAAATGCAGCCCCGTCTTGTCCAAGACCATTTGCATTTCCTGCACGAGCTGAGACACGCGCTCGACTCTCGA
GACGCTCGCTGGACGCTGTCGGTTACTCTGACGGCTCGCAATACTTGGCTCGCCCATTTCCCGCTCAAAGGCATC
CAGCACCACGCCAACTGGATCAATCTCAAAATTTGCAGCTCAAGCAAGACACAGACCAAGGACGATGCACAGCTG
CTGCTTGGCGCACACATGGACATGGCCCAAGTCACAGACAGCATCCGCGTCTTGCAGCACAATGGCATTGACGCG
GTCAATGTAGTGGTGGGCATGCCTCTCTACGGCCACGCGTTTCTTCTCGACGACCGTGCTTGCATTCACCCAGAC
GGCACTTGCAAGTACGCTGCCACAAGAACAGACTCGTGTTCCCCTGAGCCCGGGACCCTCAGCTACGCCCAACTC
GTGGCACACAACGCCAGCCAAGCGACGCAAGAATTCCACTCGTCGGCCGGTCTTTTCAAATACACCGTCCTTGAC
GACGACACATGGGTTTCGTACGACGACGCGCAAACATGGGCCGCAAAACTCAGCCTCCTGGCCAGCCTGGGCGTC
GGCGGCATTGCGCTCTGGTCTCTCAACAACGACAACAGCCGCTTCGACGCCCTGAGCGCCCTCGTCGGCGACTTC
TCCAGCCTCCAGCTACACGGCCCCCAGCTCCGCGCCGACGAGCGCATCGCCGTGGCCGAGCACTTGGCTGCCTTT
ACCGGGCAGGACTGCTTCGTCACGGCCCGCTGCAGCGACGGGTCGCGCGGCCAGCGAGCCCCTGAGCAGGTCTGT
CCGCGCGGATTCCTGTCGCTGTCGACGGCGCACACGCCGCTACAGGCGCCGCGGCAACGGCTGGGTGACGAGTGC
GGCGAGCAGTGGTATCGCCATGTGTGCTGCCCACGGAGCGCCATGCCGAAAAACTGTGCGTGGATGGGCTGTGGC
GAGCGGTGCGCAGGGGGAAAGTTTGAGTTGAATTCGGATAGATTCAAAGATGCGCGCGGAAGGGAGCAGTGTGAG
CGCGCAAGACGCCCGCTGTGCTGCGACGCGACGCCGGCCATGGCAGGGTGTCGGTGGACGTCGTGCCAGGGCCCG
TTGGCGGCGGGCGAGAAGCCTGCGTGTCCGAGGGGATTGCTCTACCAGACGCATCGTCTCGATGACCCAGACGGG
TCGGGGACGTGTGGCGCGGCGTTGTCTGGGCTGGACGCAGAGCAAGCCGTGGCGGGTGGAAAGAAAGAAGCAGAG
CAAGACGTGGCTGGTGGAAAGAAAGAAGCAGCTTTAGCCGGCTCCTTTAAAAGCGCCCTCTGCTGCCCCGATACA
AACGCCGTCTCTCGCTGTAGCTGGGCCGCATCTCCGCCACGCCCCGGCTCGCCATGTTTGCCGCAGCCGTGCCAG
CAAGGAGGCGTCTTGCTCGCCACGGCGCTGCAGCCCGCCGTCGAGCCAAACTGCTCCATAGTAGAAAAAACACAC
CGCTTCAACTACTGCTGCGAGCCACACGCCCTCGCCAAGAAGCCCCCCGTAGACCCTGCCAACCTTTTTCAAAAG
ACGTCCAGCAACGGCCCTGACGATGAGCTGGCGTGGGCGTATACCGAGAACCCATCCAACAACGACCAGAGCCAC
GTCCACCACTCCCAAACTCCTCCCGACCACGACGCCTACGGCCACGATGCGTACGGCTTCGTCATGCTGGACGGC
CCGTCGGGCTCCATCGACAACACCTTTGCCCACGTCCACACCATTGTCCGCCCCCGCGCCGGCATTGGCAAATTC
AAACGCTCCGCCGTCACCACCAACCGCACGCTCATCGACTCCGTCTTCGACGCCGCCCAGGAGACGCTACACATC
TACTGCAACTACCCCGCCGACTCGCCCGAGTGCCAGCGCCTGTGGCTCGACGGCGCGCGCGACACCGTCATCCGC
CTCCCGCACCACATTGGCCTCGGCCCGTTTGCGCGCGTCGTGTCCATCGCCGACGTGTCGCACTCCTTTTCCCTG
CCCACGCACCATCTACATCACCGCTCGCTGCAAGGTCTCGCCACGCCCGTCTACCGCCTCACCGTCGACTACAGC
TTCGACCAAATCACGCCCAAGCGCGCCAACGAGCCCGTCAACATCCGCATCGACTACACAAACCTGCTCGGGTAC
TGGGACGAAATGACCGACGCGCGCCCGGCGTCGCGGAAACGGAGCGGCGACGCGCGCGGGCTGGACTGGCATGCG
CGCGTCAATCGGGCCATTGCGCGCGACAGGCGGCTGCGCAAGCGGGCAGAGCCGATTAATGTCACGGTGCCCATG
AGCCACGGCGCCGACATGGTGGAGCGCGAGCGCGACGTGGCGCTGGATAAACGCTGGTGGGGGGCCTTTGTGGCG
TGGATCCGCCGTCTGACGACGGTGAAAAAGAGCAATGTCGGAGTCTTGCCGCTGGGGTGGAAGAGCAAGCTGAAT
CTCTTGAGGATGCGTCAGGGCTGCTCGCGACAAACCTTTTCCGCCAGCCTCGACATTGACCTCGAGGCGTCCATT
GGCCTCGACATGACGTATGCATACTACCTCTCGGGCAGCTTTATCCCCCCCAGCATCCCCGACGCCTACGCCTAC
CTGGGCATGGAGCCGCACGCCTATGCCGGCATCCGCATAGCAGGCCGTGCGCAGATGCAGTACCGCTCGGAGCGC
AAGCAGCTTATTGACACTATTACGTATCCCGGGCTGGCCATCAAGGGCATTGTTTCCATTGGGCCGACCTTTGAT
CTCTACGGCCAGATTATTGGCAAAATCACCGTCTCCGGCCAGCTCCACGCCGGCGCCCATCTCCAAGTCTCCAAA
GCCGAAGTCTACTGGCCCCAAGACGCCGCCGCCAGCAAAAAATACCAAAAACTCCTCGGCCTCGACTCCACGTCC
CACGTCCCCGCCCACGCCCCCAACCCCACCCTCGACGCCGCCCTCAAGCTCGACGCCTCGCTCGACATCTCCCTC
CAGCCCCAGGCCAGTCTCGGCATCAAGGTCGGCGGCGGCGTCGTCACCGCCGGCAAGACAATCATGGACGCCCAG
CTGTCGGGCTACTTGGTCGGCACGCTGTCCTTTCAAGCCAGCACCGATGTCGACACTAGTACCAAGACGATGCAT
TATTCGTATGGCGTGTATCTGCTCTTCAACTTGGGCTATTCGGCGAGGGCCCATATTCTGGGCCTTGTTGACTGG
GCAATGGCGCCTAGAGAGGCGTTTGTGCCGCCAAAGCAGGTTAATGTCATTGGGCCGGTCAGGGAGTCCATTTCT
TGGGGCCGACGAGAGGCTGAGCAGGTCGACATGGCCGACGGCGATTTAGACATAGGCATCAGTCGCCGTGGGCTG
AATGCTTCTGTTGAAACGAGAGAGCTGTTTGGCCGATCCCTTTCGCCTCCAGGCTAA
Transcript >OphauG2|4403
ATGGAGCTCGTCAGCAGCAGAATGGTCTTGATGCTAGTCTTGTGCATGGCTCTCACGACACAGTCAGCGCGCGAT
GGGGTCAAGGGATTAGACTTTTCCCGACGCATCGGGTTCTACGACTTGGAGGCGGCGGCGCAGGAAACCGGGTGT
GGGGGAATCCAGGTTGAAAACCTACAACTCGCGCCGCTCACGCATCTCGTTGTTGCGCACGCGTCGATTGGGACG
CACGGCAGGGTTTCGGAGAAACATGCTGGTCTCATGTACCGGGCCTCGCTGGCAAAGCTCAAGCATCCGAGTCTT
GGGATTGTCGTGTCGGTCAAGGATGATGGGGGGTCGAGGGCGTGGATGCTAGCGGCGACGTCGGCTGCAAAGAGG
CAGGTTCTGATACAGTCCATGATTGACCTTGTTGTCAAGTATGGATTCAGCGGAGTGGACCTGGATTGGTCACGG
ATTGAAATGCAGCCCCGTCTTGTCCAAGACCATTTGCATTTCCTGCACGAGCTGAGACACGCGCTCGACTCTCGA
GACGCTCGCTGGACGCTGTCGGTTACTCTGACGGCTCGCAATACTTGGCTCGCCCATTTCCCGCTCAAAGGCATC
CAGCACCACGCCAACTGGATCAATCTCAAAATTTGCAGCTCAAGCAAGACACAGACCAAGGACGATGCACAGCTG
CTGCTTGGCGCACACATGGACATGGCCCAAGTCACAGACAGCATCCGCGTCTTGCAGCACAATGGCATTGACGCG
GTCAATGTAGTGGTGGGCATGCCTCTCTACGGCCACGCGTTTCTTCTCGACGACCGTGCTTGCATTCACCCAGAC
GGCACTTGCAAGTACGCTGCCACAAGAACAGACTCGTGTTCCCCTGAGCCCGGGACCCTCAGCTACGCCCAACTC
GTGGCACACAACGCCAGCCAAGCGACGCAAGAATTCCACTCGTCGGCCGGTCTTTTCAAATACACCGTCCTTGAC
GACGACACATGGGTTTCGTACGACGACGCGCAAACATGGGCCGCAAAACTCAGCCTCCTGGCCAGCCTGGGCGTC
GGCGGCATTGCGCTCTGGTCTCTCAACAACGACAACAGCCGCTTCGACGCCCTGAGCGCCCTCGTCGGCGACTTC
TCCAGCCTCCAGCTACACGGCCCCCAGCTCCGCGCCGACGAGCGCATCGCCGTGGCCGAGCACTTGGCTGCCTTT
ACCGGGCAGGACTGCTTCGTCACGGCCCGCTGCAGCGACGGGTCGCGCGGCCAGCGAGCCCCTGAGCAGGTCTGT
CCGCGCGGATTCCTGTCGCTGTCGACGGCGCACACGCCGCTACAGGCGCCGCGGCAACGGCTGGGTGACGAGTGC
GGCGAGCAGTGGTATCGCCATGTGTGCTGCCCACGGAGCGCCATGCCGAAAAACTGTGCGTGGATGGGCTGTGGC
GAGCGGTGCGCAGGGGGAAAGTTTGAGTTGAATTCGGATAGATTCAAAGATGCGCGCGGAAGGGAGCAGTGTGAG
CGCGCAAGACGCCCGCTGTGCTGCGACGCGACGCCGGCCATGGCAGGGTGTCGGTGGACGTCGTGCCAGGGCCCG
TTGGCGGCGGGCGAGAAGCCTGCGTGTCCGAGGGGATTGCTCTACCAGACGCATCGTCTCGATGACCCAGACGGG
TCGGGGACGTGTGGCGCGGCGTTGTCTGGGCTGGACGCAGAGCAAGCCGTGGCGGGTGGAAAGAAAGAAGCAGAG
CAAGACGTGGCTGGTGGAAAGAAAGAAGCAGCTTTAGCCGGCTCCTTTAAAAGCGCCCTCTGCTGCCCCGATACA
AACGCCGTCTCTCGCTGTAGCTGGGCCGCATCTCCGCCACGCCCCGGCTCGCCATGTTTGCCGCAGCCGTGCCAG
CAAGGAGGCGTCTTGCTCGCCACGGCGCTGCAGCCCGCCGTCGAGCCAAACTGCTCCATAGTAGAAAAAACACAC
CGCTTCAACTACTGCTGCGAGCCACACGCCCTCGCCAAGAAGCCCCCCGTAGACCCTGCCAACCTTTTTCAAAAG
ACGTCCAGCAACGGCCCTGACGATGAGCTGGCGTGGGCGTATACCGAGAACCCATCCAACAACGACCAGAGCCAC
GTCCACCACTCCCAAACTCCTCCCGACCACGACGCCTACGGCCACGATGCGTACGGCTTCGTCATGCTGGACGGC
CCGTCGGGCTCCATCGACAACACCTTTGCCCACGTCCACACCATTGTCCGCCCCCGCGCCGGCATTGGCAAATTC
AAACGCTCCGCCGTCACCACCAACCGCACGCTCATCGACTCCGTCTTCGACGCCGCCCAGGAGACGCTACACATC
TACTGCAACTACCCCGCCGACTCGCCCGAGTGCCAGCGCCTGTGGCTCGACGGCGCGCGCGACACCGTCATCCGC
CTCCCGCACCACATTGGCCTCGGCCCGTTTGCGCGCGTCGTGTCCATCGCCGACGTGTCGCACTCCTTTTCCCTG
CCCACGCACCATCTACATCACCGCTCGCTGCAAGGTCTCGCCACGCCCGTCTACCGCCTCACCGTCGACTACAGC
TTCGACCAAATCACGCCCAAGCGCGCCAACGAGCCCGTCAACATCCGCATCGACTACACAAACCTGCTCGGGTAC
TGGGACGAAATGACCGACGCGCGCCCGGCGTCGCGGAAACGGAGCGGCGACGCGCGCGGGCTGGACTGGCATGCG
CGCGTCAATCGGGCCATTGCGCGCGACAGGCGGCTGCGCAAGCGGGCAGAGCCGATTAATGTCACGGTGCCCATG
AGCCACGGCGCCGACATGGTGGAGCGCGAGCGCGACGTGGCGCTGGATAAACGCTGGTGGGGGGCCTTTGTGGCG
TGGATCCGCCGTCTGACGACGGTGAAAAAGAGCAATGTCGGAGTCTTGCCGCTGGGGTGGAAGAGCAAGCTGAAT
CTCTTGAGGATGCGTCAGGGCTGCTCGCGACAAACCTTTTCCGCCAGCCTCGACATTGACCTCGAGGCGTCCATT
GGCCTCGACATGACGTATGCATACTACCTCTCGGGCAGCTTTATCCCCCCCAGCATCCCCGACGCCTACGCCTAC
CTGGGCATGGAGCCGCACGCCTATGCCGGCATCCGCATAGCAGGCCGTGCGCAGATGCAGTACCGCTCGGAGCGC
AAGCAGCTTATTGACACTATTACGTATCCCGGGCTGGCCATCAAGGGCATTGTTTCCATTGGGCCGACCTTTGAT
CTCTACGGCCAGATTATTGGCAAAATCACCGTCTCCGGCCAGCTCCACGCCGGCGCCCATCTCCAAGTCTCCAAA
GCCGAAGTCTACTGGCCCCAAGACGCCGCCGCCAGCAAAAAATACCAAAAACTCCTCGGCCTCGACTCCACGTCC
CACGTCCCCGCCCACGCCCCCAACCCCACCCTCGACGCCGCCCTCAAGCTCGACGCCTCGCTCGACATCTCCCTC
CAGCCCCAGGCCAGTCTCGGCATCAAGGTCGGCGGCGGCGTCGTCACCGCCGGCAAGACAATCATGGACGCCCAG
CTGTCGGGCTACTTGGTCGGCACGCTGTCCTTTCAAGCCAGCACCGATGTCGACACTAGTACCAAGACGATGCAT
TATTCGTATGGCGTGTATCTGCTCTTCAACTTGGGCTATTCGGCGAGGGCCCATATTCTGGGCCTTGTTGACTGG
GCAATGGCGCCTAGAGAGGCGTTTGTGCCGCCAAAGCAGGTTAATGTCATTGGGCCGGTCAGGGAGTCCATTTCT
TGGGGCCGACGAGAGGCTGAGCAGGTCGACATGGCCGACGGCGATTTAGACATAGGCATCAGTCGCCGTGGGCTG
AATGCTTCTGTTGAAACGAGAGAGCTGTTTGGCCGATCCCTTTCGCCTCCAGGCTAA
Gene >OphauG2|4403
ATGGAGCTCGTCAGCAGCAGAATGGTCTTGATGCTAGTCTTGTGCATGGCTCTCACGACACAGTCAGCGCGCGAT
GGGGTCAAGGGATTAGACTTTTCCCGACGCATCGGGTTCTACGACTTGGAGGCGGCGGCGCAGGAAACCGGGTGT
GGGGGAATCCAGGTTGAAAACCTACAACTCGCGCCGCTCACGCATCTCGTTGTTGCGCACGCGTCGATTGGGACG
CACGGCAGGGTTTCGGAGAAACATGCTGGTCTCATGTACCGGGCCTCGCTGGCAAAGCTCAAGCATCCGAGTCTT
GGGATTGTCGTGTCGGTCAAGGATGATGGGGGGTCGAGGGCGTGGATGCTAGGTGACGAGGCCTTTTGCACATTG
ATCACGACGACAAGTGGGAGACTAATGGATGGGGGGTAGCGGCGACGTCGGCTGCAAAGAGGCAGGTTCTGATAC
AGTCCATGATTGACCTTGTTGTCAAGTATGGATTCAGCGGAGTGGACCTGGGTATCGCGGCTCTTTTCCCTTGGT
GCTCAAGGCGTATGCTGATTCCGTATAGATTGGTCACGGATTGAAATGCAGCCCCGTCTTGTCCAAGACCATTTG
CATTTCCTGCACGAGCTGAGACACGCGCTCGACTCTCGAGACGCTCGCTGGACGCTGTCGGTTACTCTGACGGCT
CGCAATACTTGGCTCGCCCATTTCCCGCTCAAAGGCATCCAGCACCACGCCAACTGGATCAATCTCAAAATTTGC
AGCTCAGTAAGCTACCCTCCCCACGTACCAAGGGCAAGATTATGACGCGTTGACGAGCAGAGCAAGACACAGACC
AAGGACGATGCACAGCTGCTGCTTGGCGCACACATGGACATGGCCCAAGTCACAGACAGCATCCGCGTCTTGCAG
CACAATGGCATTGACGCGGTCAATGTAGTGGTGGGCATGCCTCTCTACGGCCACGCGTTTCTTCTCGACGACCGT
GCTTGCATTCACCCAGACGGCACTTGCAAGTACGCTGCCACAAGAACAGACTCGTGTTCCCCTGAGCCCGGGACC
CTCAGCTACGCCCAACTCGTGGCACACAACGCCAGCCAAGCGACGCAAGAATTCCACTCGTCGGCCGGTCTTTTC
AAATACACCGTCCTTGACGACGACACATGGGTTTCGTACGACGACGCGCAAACATGGGCCGCAAAACTCAGCCTC
CTGGCCAGCCTGGGCGTCGGCGGCATTGCGCTCTGGTCTCTCAACAACGACAACAGCCGCTTCGACGCCCTGAGC
GCCCTCGTCGGCGACTTCTCCAGCCTCCAGCTACACGGCCCCCAGCTCCGCGCCGACGAGCGCATCGCCGTGGCC
GAGCACTTGGCTGCCTTTACCGGGCAGGACTGCTTCGTCACGGCCCGCTGCAGCGACGGGTCGCGCGGCCAGCGA
GCCCCTGAGCAGGTCTGTCCGCGCGGATTCCTGTCGCTGTCGACGGCGCACACGCCGCTACAGGCGCCGCGGCAA
CGGCTGGGTGACGAGTGCGGCGAGCAGTGGTATCGCCATGTGTGCTGCCCACGGAGCGCCATGCCGAAAAACTGT
GCGTGGATGGGCTGTGGCGAGCGGTGCGCAGGGGGAAAGTTTGAGTTGAATTCGGATAGATTCAAAGATGCGCGC
GGAAGGGAGCAGTGTGAGCGCGCAAGACGCCCGCTGTGCTGCGACGCGACGCCGGCCATGGCAGGGTGTCGGTGG
ACGTCGTGCCAGGGCCCGTTGGCGGCGGGCGAGAAGCCTGCGTGTCCGAGGGGATTGCTCTACCAGACGCATCGT
CTCGATGACCCAGACGGGTCGGGGACGTGTGGCGCGGCGTTGTCTGGGCTGGACGCAGAGCAAGCCGTGGCGGGT
GGAAAGAAAGAAGCAGAGCAAGACGTGGCTGGTGGAAAGAAAGAAGCAGCTTTAGCCGGCTCCTTTAAAAGCGCC
CTCTGCTGCCCCGATACAAACGCCGTCTCTCGCTGTAGCTGGGCCGCATCTCCGCCACGCCCCGGCTCGCCATGT
TTGCCGCAGCCGTGCCAGCAAGGAGGCGTCTTGCTCGCCACGGCGCTGCAGCCCGCCGTCGAGCCAAACTGCTCC
ATAGTAGAAAAAACACACCGCTTCAACTACTGCTGCGAGCCACACGCCCTCGCCAAGAAGCCCCCCGTAGACCCT
GCCAACCTTTTTCAAAAGACGTCCAGCAACGGCCCTGACGATGAGCTGGCGTGGGCGTATACCGAGAACCCATCC
AACAACGACCAGAGCCACGTCCACCACTCCCAAACTCCTCCCGACCACGACGCCTACGGCCACGATGCGTACGGC
TTCGTCATGCTGGACGGCCCGTCGGGCTCCATCGACAACACCTTTGCCCACGTCCACACCATTGTCCGCCCCCGC
GCCGGCATTGGCAAATTCAAACGCTCCGCCGTCACCACCAACCGCACGCTCATCGACTCCGTCTTCGACGCCGCC
CAGGAGACGCTACACATCTACTGCAACTACCCCGCCGACTCGCCCGAGTGCCAGCGCCTGTGGCTCGACGGCGCG
CGCGACACCGTCATCCGCCTCCCGCACCACATTGGCCTCGGCCCGTTTGCGCGCGTCGTGTCCATCGCCGACGTG
TCGCACTCCTTTTCCCTGCCCACGCACCATCTACATCACCGCTCGCTGCAAGGTCTCGCCACGCCCGTCTACCGC
CTCACCGTCGACTACAGCTTCGACCAAATCACGCCCAAGCGCGCCAACGAGCCCGTCAACATCCGCATCGACTAC
ACAAACCTGCTCGGGTACTGGGACGAAATGACCGACGCGCGCCCGGCGTCGCGGAAACGGAGCGGCGACGCGCGC
GGGCTGGACTGGCATGCGCGCGTCAATCGGGCCATTGCGCGCGACAGGCGGCTGCGCAAGCGGGCAGAGCCGATT
AATGTCACGGTGCCCATGAGCCACGGCGCCGACATGGTGGAGCGCGAGCGCGACGTGGCGCTGGATAAACGCTGG
TGGGGGGCCTTTGTGGCGTGGATCCGCCGTCTGGTGAGAGAGAGAGAGAGCCCCCGACAATGTCTGATTTTTGGT
ATTGACTCTTGTGCCTGGTTGGGTTTTTCTAGACGACGGTGAAAAAGAGCAATGTCGGAGTCTTGCCGCTGGGGT
GGAAGAGCAAGCTGAATCTCTTGAGGATGCGTCAGGGGTGAGTGGCTCCTTTTCCCCCTTGGCCATTTTGTCTTT
TTTCCACCATTGTCAACCATGCTGTTTCTTCCACTCTTGTCAACCATGCTGTTTCTTCCACTCTTGCCAACTATG
CTGTTAAAACGTCGTCTCAGCTGCTCGCGACAAACCTTTTCCGCCAGCCTCGACATTGACCTCGAGGCGTCCATT
GGCCTCGACATGACGTATGCATACTACCTCTCGGGCAGCTTTATCCCCCCCAGCATCCCCGACGCCTACGCCTAC
CTGGGCATGGAGCCGCACGCCTATGCCGGCATCCGCATAGCAGGCCGTGCGCAGATGCAGTACCGCTCGGAGCGC
AAGCAGCTTATTGACACTATTACGTATCCCGGGCTGGCCATCAAGGGCATTGTTTCCATTGGGCCGACCTTTGAT
CTCTACGGCCAGGTGTGCCTTTTCCCTTTTTTCCCTCTTCTTCTCTTTGTATCTTCTTCTCTTCGTCTCCTCTTT
CTAGATTCTACCCCTGTTCAAGCACTTACAAGCTCAAGCTAGATTATTGGCAAAATCACCGTCTCCGGCCAGCTC
CACGCCGGCGCCCATCTCCAAGTCTCCAAAGCCGAAGTCTACTGGCCCCAAGACGCCGCCGCCAGCAAAAAATAC
CAAAAACTCCTCGGCCTCGACTCCACGTCCCACGTCCCCGCCCACGCCCCCAACCCCACCCTCGACGCCGCCCTC
AAGCTCGACGCCTCGCTCGACATCTCCCTCCAGCCCCAGGCCAGTCTCGGCATCAAGGTCGGCGGCGGCGTCGTC
ACCGCCGGCAAGACAATCATGGACGCCCAGCTGTCGGGCTACTTGGTCGGCACGCTGTCCTTTCAAGCCAGCACC
GATGTCGACACTAGTACCAAGACGATGCATTATTCGTATGGCGTGTATCTGCTCTTCAACTTGGGCTATTCGGCG
AGGGCCCATATTCTGGGCCTTGTTGACTGGGCAATGGCGCCTAGAGAGGCGTTTGTGCCGCCAAAGCAGGTTAAT
GTCATTGGGCCGGTCAGGGAGTCCATTTCTTGGGGCCGACGAGAGGCTGAGCAGGTCGACATGGCCGACGGCGAT
TTAGACATAGGCATCAGTCGCCGTGGGCTGAATGCTTCTGTTGAAACGAGAGAGCTGTTTGGCCGATCCCTTTCG
CCTCCAGGTATCTCCCCCTCCAATTCGCCTCTATCCATCCTCCACGCCCCCCTTTTCATTCATAGCGACAAGGCT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail