© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | OphauG2|44 |
| Gene name | |
| Location | Contig_1:105358..106645 |
| Strand | + |
| Gene length (bp) | 1287 |
| Transcript length (bp) | 1164 |
| Coding sequence length (bp) | 1164 |
| Protein length (aa) | 388 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 4.0E-17 | 78 | 205 |
| PF08542 | Rep_fac_C | Replication factor C C-terminal domain | 7.8E-14 | 290 | 375 |
| PF13177 | DNA_pol3_delta2 | DNA polymerase III, delta subunit | 2.8E-11 | 59 | 207 |
| PF03215 | Rad17 | Rad17 P-loop domain | 1.5E-08 | 41 | 175 |
| PF13604 | AAA_30 | AAA domain | 3.1E-06 | 78 | 177 |
| PF07728 | AAA_5 | AAA domain (dynein-related subfamily) | 4.9E-05 | 77 | 178 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O74111|RFC3_BLAAD | Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 | 39 | 384 | 2.0E-135 |
| sp|O14003|RFC3_SCHPO | Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc3 PE=1 SV=2 | 21 | 387 | 2.0E-127 |
| sp|P38629|RFC3_YEAST | Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 | 38 | 383 | 1.0E-115 |
| sp|Q54ST4|RFC5_DICDI | Probable replication factor C subunit 5 OS=Dictyostelium discoideum GN=rfc5 PE=3 SV=1 | 40 | 379 | 4.0E-106 |
| sp|Q9CAQ8|RFC5_ARATH | Replication factor C subunit 5 OS=Arabidopsis thaliana GN=RFC5 PE=1 SV=1 | 1 | 375 | 3.0E-102 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O74111|RFC3_BLAAD | Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 | 39 | 384 | 2.0E-135 |
| sp|O14003|RFC3_SCHPO | Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc3 PE=1 SV=2 | 21 | 387 | 2.0E-127 |
| sp|P38629|RFC3_YEAST | Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 | 38 | 383 | 1.0E-115 |
| sp|Q54ST4|RFC5_DICDI | Probable replication factor C subunit 5 OS=Dictyostelium discoideum GN=rfc5 PE=3 SV=1 | 40 | 379 | 4.0E-106 |
| sp|Q9CAQ8|RFC5_ARATH | Replication factor C subunit 5 OS=Arabidopsis thaliana GN=RFC5 PE=1 SV=1 | 1 | 375 | 3.0E-102 |
| sp|P40937|RFC5_HUMAN | Replication factor C subunit 5 OS=Homo sapiens GN=RFC5 PE=1 SV=1 | 41 | 379 | 3.0E-101 |
| sp|Q9D0F6|RFC5_MOUSE | Replication factor C subunit 5 OS=Mus musculus GN=Rfc5 PE=1 SV=1 | 41 | 379 | 9.0E-100 |
| sp|Q6YZ54|RFC3_ORYSJ | Replication factor C subunit 3 OS=Oryza sativa subsp. japonica GN=RFC3 PE=2 SV=1 | 43 | 381 | 3.0E-98 |
| sp|P34429|RFC5_CAEEL | Probable replication factor C subunit 5 OS=Caenorhabditis elegans GN=F44B9.8 PE=3 SV=3 | 41 | 370 | 7.0E-95 |
| sp|Q9HN27|RFCS_HALSA | Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcS PE=3 SV=1 | 44 | 378 | 3.0E-73 |
| sp|B0R7H7|RFCS_HALS3 | Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcS PE=3 SV=1 | 44 | 378 | 3.0E-73 |
| sp|Q0W037|RFCS_METAR | Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 | 38 | 375 | 9.0E-72 |
| sp|A3DNV9|RFCS_STAMF | Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcS PE=3 SV=1 | 42 | 376 | 1.0E-71 |
| sp|Q4JAB0|RFCS_SULAC | Replication factor C small subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcS PE=3 SV=1 | 39 | 376 | 2.0E-71 |
| sp|A6US36|RFCS_METVS | Replication factor C small subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcS PE=3 SV=1 | 43 | 376 | 7.0E-71 |
| sp|Q6M044|RFCS_METMP | Replication factor C small subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcS PE=3 SV=1 | 43 | 376 | 4.0E-70 |
| sp|A6VJ61|RFCS_METM7 | Replication factor C small subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcS PE=3 SV=1 | 43 | 376 | 5.0E-70 |
| sp|O28219|RFCS_ARCFU | Replication factor C small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcS PE=1 SV=1 | 44 | 378 | 7.0E-70 |
| sp|A9A6K6|RFCS_METM6 | Replication factor C small subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcS PE=3 SV=1 | 43 | 376 | 5.0E-69 |
| sp|A4FZ74|RFCS_METM5 | Replication factor C small subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcS PE=3 SV=1 | 43 | 376 | 5.0E-69 |
| sp|Q5UZE5|RFCS_HALMA | Replication factor C small subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcS PE=3 SV=2 | 44 | 381 | 8.0E-69 |
| sp|Q9YBS7|RFCS_AERPE | Replication factor C small subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcS PE=3 SV=3 | 44 | 376 | 1.0E-68 |
| sp|A4WGV2|RFCS1_PYRAR | Replication factor C small subunit 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS1 PE=3 SV=1 | 42 | 367 | 1.0E-67 |
| sp|Q975D3|RFCS_SULTO | Replication factor C small subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcS PE=3 SV=1 | 39 | 387 | 2.0E-67 |
| sp|Q54MD4|RFC4_DICDI | Probable replication factor C subunit 4 OS=Dictyostelium discoideum GN=rfc4 PE=3 SV=1 | 36 | 370 | 4.0E-67 |
| sp|A1RSA2|RFCS1_PYRIL | Replication factor C small subunit 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS1 PE=3 SV=1 | 42 | 376 | 4.0E-67 |
| sp|Q09843|RFC2_SCHPO | Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc2 PE=1 SV=1 | 37 | 370 | 9.0E-67 |
| sp|Q8ZYK4|RFCS1_PYRAE | Replication factor C small subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS1 PE=3 SV=1 | 41 | 375 | 1.0E-65 |
| sp|P60374|RFCS_NANEQ | Replication factor C small subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcS PE=3 SV=1 | 44 | 376 | 2.0E-65 |
| sp|P35249|RFC4_HUMAN | Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2 | 42 | 378 | 3.0E-65 |
| sp|Q9UXF5|RFCS_SULSO | Replication factor C small subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcS PE=1 SV=1 | 40 | 376 | 6.0E-65 |
| sp|Q99J62|RFC4_MOUSE | Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1 | 42 | 378 | 1.0E-64 |
| sp|Q3ITJ2|RFCS_NATPD | Replication factor C small subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcS PE=3 SV=1 | 44 | 366 | 2.0E-64 |
| sp|Q5UP47|RFCS3_MIMIV | Putative replication factor C small subunit L499 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L499 PE=3 SV=1 | 37 | 358 | 3.0E-64 |
| sp|A3MS28|RFCS_PYRCJ | Replication factor C small subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcS PE=3 SV=1 | 42 | 370 | 7.0E-64 |
| sp|Q46C63|RFCS_METBF | Replication factor C small subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcS PE=3 SV=1 | 44 | 376 | 1.0E-63 |
| sp|O26343|RFCS_METTH | Replication factor C small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcS PE=1 SV=1 | 43 | 376 | 2.0E-63 |
| sp|A1RWU7|RFCS_THEPD | Replication factor C small subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcS PE=3 SV=1 | 44 | 375 | 6.0E-63 |
| sp|Q8PVY4|RFCS_METMA | Replication factor C small subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcS PE=3 SV=1 | 44 | 376 | 2.0E-62 |
| sp|Q6L1I0|RFCS_PICTO | Replication factor C small subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcS PE=3 SV=1 | 44 | 378 | 2.0E-62 |
| sp|P0C7N7|RFC2_PHANO | Replication factor C subunit 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RFC2 PE=3 SV=1 | 43 | 386 | 4.0E-61 |
| sp|Q8TSX5|RFCS_METAC | Replication factor C small subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcS PE=3 SV=1 | 44 | 375 | 1.0E-60 |
| sp|P40348|RFC2_YEAST | Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC2 PE=1 SV=1 | 38 | 370 | 7.0E-60 |
| sp|Q2FQT9|RFCS_METHJ | Replication factor C small subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcS PE=3 SV=1 | 44 | 381 | 9.0E-60 |
| sp|A7I8Y0|RFCS_METB6 | Replication factor C small subunit OS=Methanoregula boonei (strain 6A8) GN=rfcS PE=3 SV=1 | 44 | 376 | 2.0E-59 |
| sp|Q8ZWS2|RFCS2_PYRAE | Replication factor C small subunit 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS2 PE=3 SV=1 | 42 | 287 | 5.0E-59 |
| sp|A2SQT3|RFCS_METLZ | Replication factor C small subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcS PE=3 SV=1 | 44 | 382 | 1.0E-58 |
| sp|Q2NH89|RFCS_METST | Replication factor C small subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcS PE=3 SV=1 | 43 | 375 | 2.0E-58 |
| sp|Q93ZX1|RFC4_ARATH | Replication factor C subunit 4 OS=Arabidopsis thaliana GN=RFC4 PE=2 SV=1 | 39 | 252 | 3.0E-58 |
| sp|A4WLY0|RFCS2_PYRAR | Replication factor C small subunit 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS2 PE=3 SV=1 | 42 | 377 | 4.0E-58 |
| sp|A1RV38|RFCS2_PYRIL | Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 | 42 | 256 | 2.0E-57 |
| sp|Q977Z9|RFCS_THEVO | Replication factor C small subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcS PE=3 SV=2 | 44 | 376 | 2.0E-57 |
| sp|Q9FXM3|RFC2_ORYSJ | Replication factor C subunit 2 OS=Oryza sativa subsp. japonica GN=RFC2 PE=2 SV=1 | 41 | 252 | 3.0E-57 |
| sp|Q9HI47|RFCS_THEAC | Replication factor C small subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcS PE=3 SV=2 | 44 | 376 | 4.0E-57 |
| sp|A5UMF3|RFCS_METS3 | Replication factor C small subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcS PE=3 SV=1 | 41 | 375 | 8.0E-57 |
| sp|Q05B83|RFC2_BOVIN | Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 | 27 | 375 | 1.0E-56 |
| sp|A3CUX9|RFCS_METMJ | Replication factor C small subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcS PE=3 SV=1 | 44 | 376 | 2.0E-56 |
| sp|Q7XRX1|RFC4_ORYSJ | Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 | 42 | 375 | 6.0E-56 |
| sp|Q9WUK4|RFC2_MOUSE | Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 | 42 | 289 | 1.0E-55 |
| sp|Q641W4|RFC2_RAT | Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 | 42 | 289 | 1.0E-55 |
| sp|P35250|RFC2_HUMAN | Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 | 42 | 375 | 2.0E-55 |
| sp|Q54E21|RFC2_DICDI | Probable replication factor C subunit 2 OS=Dictyostelium discoideum GN=rfc2 PE=3 SV=1 | 42 | 268 | 4.0E-55 |
| sp|P53033|RFC2_CHICK | Replication factor C subunit 2 OS=Gallus gallus GN=RFC2 PE=2 SV=1 | 42 | 289 | 1.0E-54 |
| sp|Q9CAM7|RFC2_ARATH | Replication factor C subunit 2 OS=Arabidopsis thaliana GN=RFC2 PE=1 SV=1 | 43 | 375 | 2.0E-54 |
| sp|P53034|RFC2_DROME | Replication factor C subunit 2 OS=Drosophila melanogaster GN=RfC4 PE=2 SV=1 | 42 | 288 | 8.0E-52 |
| sp|Q8SQM0|RFC4_ENCCU | Replication factor C subunit 4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RFC4 PE=1 SV=1 | 45 | 318 | 5.0E-51 |
| sp|P40339|RFC4_YEAST | Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC4 PE=1 SV=1 | 42 | 379 | 2.0E-50 |
| sp|O94449|RFC4_SCHPO | Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 | 42 | 268 | 5.0E-50 |
| sp|Q5UQ72|RFCS4_MIMIV | Putative replication factor C small subunit L510 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R510 PE=3 SV=1 | 39 | 370 | 1.0E-48 |
| sp|P53016|RFC4_CAEEL | Replication factor C subunit 4 OS=Caenorhabditis elegans GN=rfc-4 PE=1 SV=1 | 35 | 252 | 1.0E-47 |
| sp|O57852|RFCS_PYRHO | Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 | 83 | 375 | 9.0E-45 |
| sp|Q8U4J3|RFCS_PYRFU | Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 | 83 | 375 | 1.0E-44 |
| sp|Q18E75|RFCS_HALWD | Replication factor C small subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcS PE=3 SV=1 | 99 | 375 | 5.0E-44 |
| sp|Q5JHP2|RFCS_THEKO | Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 | 83 | 375 | 2.0E-43 |
| sp|Q8TZC4|RFCS_METKA | Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 | 112 | 375 | 9.0E-36 |
| sp|Q5UQ47|RFCS1_MIMIV | Putative replication factor C small subunit R395 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R395 PE=3 SV=1 | 40 | 379 | 2.0E-34 |
| sp|Q8VXX4|RFC3_ARATH | Replication factor C subunit 3 OS=Arabidopsis thaliana GN=RFC3 PE=2 SV=1 | 44 | 307 | 2.0E-32 |
| sp|Q54BN3|RFC3_DICDI | Probable replication factor C subunit 3 OS=Dictyostelium discoideum GN=rfc3 PE=3 SV=1 | 44 | 376 | 5.0E-32 |
| sp|Q2TBV1|RFC3_BOVIN | Replication factor C subunit 3 OS=Bos taurus GN=RFC3 PE=2 SV=1 | 44 | 272 | 2.0E-31 |
| sp|P40938|RFC3_HUMAN | Replication factor C subunit 3 OS=Homo sapiens GN=RFC3 PE=1 SV=2 | 44 | 272 | 7.0E-31 |
| sp|Q8R323|RFC3_MOUSE | Replication factor C subunit 3 OS=Mus musculus GN=Rfc3 PE=1 SV=1 | 44 | 260 | 3.0E-30 |
| sp|Q852K3|RFC5_ORYSJ | Replication factor C subunit 5 OS=Oryza sativa subsp. japonica GN=RFC5 PE=2 SV=1 | 44 | 260 | 5.0E-30 |
| sp|P38251|RFC5_YEAST | Replication factor C subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC5 PE=1 SV=1 | 44 | 252 | 5.0E-27 |
| sp|A5UMF4|RFCL_METS3 | Replication factor C large subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcL PE=3 SV=1 | 44 | 289 | 1.0E-25 |
| sp|O29072|RFCL_ARCFU | Replication factor C large subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcL PE=1 SV=1 | 44 | 287 | 7.0E-25 |
| sp|Q8X082|RFC5_NEUCR | Replication factor C subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.460 PE=3 SV=1 | 45 | 376 | 7.0E-24 |
| sp|O94697|RFC5_SCHPO | Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc5 PE=1 SV=1 | 44 | 257 | 2.0E-23 |
| sp|A7I781|RFCL_METB6 | Replication factor C large subunit OS=Methanoregula boonei (strain 6A8) GN=rfcL PE=3 SV=1 | 42 | 287 | 4.0E-23 |
| sp|Q8Q084|RFCL_METMA | Replication factor C large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcL PE=3 SV=1 | 41 | 264 | 1.0E-22 |
| sp|Q8TPU4|RFCL_METAC | Replication factor C large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcL PE=3 SV=1 | 41 | 264 | 4.0E-22 |
| sp|Q46AT6|RFCL_METBF | Replication factor C large subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcL PE=3 SV=1 | 41 | 264 | 5.0E-22 |
| sp|Q5V1F7|RFCL_HALMA | Replication factor C large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcL PE=3 SV=1 | 42 | 349 | 7.0E-22 |
| sp|A0B6D7|RFCL_METTP | Replication factor C large subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rfcL PE=3 SV=1 | 44 | 252 | 1.0E-20 |
| sp|Q2FQR4|RFCL_METHJ | Replication factor C large subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcL PE=3 SV=1 | 44 | 252 | 2.0E-20 |
| sp|A4FZL6|RFCL_METM5 | Replication factor C large subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcL PE=3 SV=1 | 44 | 301 | 2.0E-20 |
| sp|A9A6N2|RFCL_METM6 | Replication factor C large subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcL PE=3 SV=1 | 44 | 272 | 7.0E-20 |
| sp|Q58294|RFCL_METJA | Replication factor C large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcL PE=1 SV=1 | 42 | 270 | 1.0E-19 |
| sp|Q975D4|RFCL_SULTO | Replication factor C large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcL PE=3 SV=2 | 42 | 253 | 1.0E-19 |
| sp|Q9V2G4|RFCS_PYRAB | Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 | 26 | 183 | 2.0E-19 |
| sp|A6URV8|RFCL_METVS | Replication factor C large subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcL PE=3 SV=1 | 44 | 301 | 2.0E-19 |
| sp|A6VIW1|RFCL_METM7 | Replication factor C large subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcL PE=3 SV=1 | 44 | 301 | 2.0E-19 |
| sp|Q2NH88|RFCL_METST | Replication factor C large subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcL PE=3 SV=1 | 42 | 252 | 2.0E-19 |
| sp|Q9V2G3|RFCL_PYRAB | Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 | 42 | 257 | 4.0E-19 |
| sp|A1RWU6|RFCL_THEPD | Replication factor C large subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1 | 42 | 287 | 1.0E-18 |
| sp|Q12TX1|RFCL_METBU | Replication factor C large subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rfcL PE=3 SV=1 | 40 | 253 | 1.0E-18 |
| sp|Q9UWR2|RFCL_PYRFU | Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 | 42 | 253 | 1.0E-18 |
| sp|Q58817|RFCS_METJA | Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 | 186 | 387 | 2.0E-18 |
| sp|Q3ISA5|RFCL_NATPD | Replication factor C large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcL PE=3 SV=1 | 44 | 252 | 2.0E-18 |
| sp|Q5JHP1|RFCL_THEKO | Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 | 41 | 253 | 2.0E-18 |
| sp|O57853|RFCL_PYRHO | Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 | 42 | 257 | 3.0E-18 |
| sp|A6UWR5|RFCL_META3 | Replication factor C large subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rfcL PE=3 SV=1 | 42 | 272 | 8.0E-18 |
| sp|Q9HPI4|RFCL_HALSA | Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcL PE=3 SV=2 | 42 | 349 | 1.0E-17 |
| sp|B0R601|RFCL_HALS3 | Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcL PE=3 SV=1 | 42 | 349 | 1.0E-17 |
| sp|Q4JAB1|RFCL_SULAC | Replication factor C large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcL PE=3 SV=1 | 42 | 252 | 2.0E-17 |
| sp|Q9UXF6|RFCL_SULSO | Replication factor C large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcL PE=1 SV=1 | 42 | 252 | 2.0E-17 |
| sp|A3CTR4|RFCL_METMJ | Replication factor C large subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcL PE=3 SV=1 | 42 | 253 | 2.0E-17 |
| sp|O26342|RFCL_METTH | Replication factor C large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcL PE=1 SV=1 | 42 | 289 | 2.0E-17 |
| sp|Q6M0E9|RFCL_METMP | Replication factor C large subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcL PE=3 SV=1 | 44 | 272 | 3.0E-17 |
| sp|C4KHA7|RFCL_SULIK | Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rfcL PE=3 SV=1 | 42 | 252 | 1.0E-16 |
| sp|C3NE95|RFCL_SULIY | Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rfcL PE=3 SV=1 | 42 | 252 | 2.0E-16 |
| sp|C3MQ13|RFCL_SULIL | Replication factor C large subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rfcL PE=3 SV=1 | 42 | 252 | 2.0E-16 |
| sp|C3MVD2|RFCL_SULIM | Replication factor C large subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rfcL PE=3 SV=1 | 42 | 252 | 2.0E-16 |
| sp|C3N5N1|RFCL_SULIA | Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.27) GN=rfcL PE=3 SV=1 | 42 | 252 | 2.0E-16 |
| sp|C3NHF4|RFCL_SULIN | Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rfcL PE=3 SV=1 | 42 | 252 | 5.0E-16 |
| sp|Q18GQ9|RFCL_HALWD | Replication factor C large subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcL PE=3 SV=1 | 44 | 251 | 6.0E-16 |
| sp|O64301|DPA44_BPR69 | DNA polymerase accessory protein 44 OS=Enterobacteria phage RB69 GN=44 PE=4 SV=1 | 46 | 247 | 7.0E-16 |
| sp|A2SQR6|RFCL_METLZ | Replication factor C large subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcL PE=3 SV=1 | 42 | 250 | 2.0E-15 |
| sp|Q9V2G4|RFCS_PYRAB | Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 | 186 | 375 | 4.0E-15 |
| sp|Q8TZC5|RFCL_METKA | Replication factor C large subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcL PE=3 SV=1 | 42 | 309 | 6.0E-15 |
| sp|Q75JU2|WRIP1_DICDI | ATPase WRNIP1 OS=Dictyostelium discoideum GN=wrnip1 PE=3 SV=1 | 43 | 250 | 7.0E-15 |
| sp|Q8TZC4|RFCS_METKA | Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 | 42 | 115 | 1.0E-14 |
| sp|P9WQN1|Y2559_MYCTU | Uncharacterized AAA domain-containing protein Rv2559c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2559c PE=1 SV=1 | 43 | 248 | 1.0E-14 |
| sp|P9WQN0|Y2559_MYCTO | Uncharacterized AAA domain-containing protein MT2636 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2636 PE=3 SV=1 | 43 | 248 | 1.0E-14 |
| sp|Q5UQE8|RFCS2_MIMIV | Putative replication factor C small subunit L478 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L478 PE=3 SV=1 | 44 | 247 | 1.0E-14 |
| sp|P60373|RFCL_NANEQ | Replication factor C large subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcL PE=3 SV=1 | 42 | 258 | 2.0E-14 |
| sp|B9LPV1|RFCL_HALLT | Replication factor C large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rfcL PE=3 SV=1 | 44 | 253 | 2.0E-14 |
| sp|A3DNV8|RFCL_STAMF | Replication factor C large subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcL PE=3 SV=1 | 42 | 252 | 3.0E-14 |
| sp|Q0W3P4|RFCL_METAR | Replication factor C large subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcL PE=3 SV=1 | 40 | 339 | 4.0E-14 |
| sp|O60182|RFC1_SCHPO | Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc1 PE=1 SV=1 | 37 | 265 | 6.0E-14 |
| sp|P9WNT9|DPO3X_MYCTU | DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaX PE=1 SV=1 | 47 | 250 | 7.0E-14 |
| sp|P9WNT8|DPO3X_MYCTO | DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaX PE=3 SV=1 | 47 | 250 | 7.0E-14 |
| sp|P63976|DPO3X_MYCBO | DNA polymerase III subunit gamma/tau OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaX PE=3 SV=1 | 47 | 250 | 7.0E-14 |
| sp|Q9WYX8|Y508_THEMA | Uncharacterized protein TM_0508 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0508 PE=3 SV=1 | 43 | 273 | 9.0E-14 |
| sp|P04526|DPA44_BPT4 | Sliding-clamp-loader gp44 subunit OS=Enterobacteria phage T4 GN=44 PE=1 SV=1 | 46 | 271 | 1.0E-13 |
| sp|A2BL93|RFCL_HYPBU | Replication factor C large subunit OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rfcL PE=3 SV=1 | 40 | 253 | 2.0E-13 |
| sp|F4JRP8|STIL2_ARATH | Protein STICHEL-like 2 OS=Arabidopsis thaliana GN=At4g24790 PE=2 SV=1 | 46 | 246 | 2.0E-13 |
| sp|P09122|DPO3X_BACSU | DNA polymerase III subunit gamma/tau OS=Bacillus subtilis (strain 168) GN=dnaX PE=3 SV=3 | 48 | 265 | 3.0E-13 |
| sp|O34528|YRVN_BACSU | Uncharacterized AAA domain-containing protein YrvN OS=Bacillus subtilis (strain 168) GN=yrvN PE=3 SV=1 | 43 | 251 | 5.0E-13 |
| sp|O64728|STI_ARATH | Protein STICHEL OS=Arabidopsis thaliana GN=STI PE=1 SV=2 | 37 | 246 | 8.0E-13 |
| sp|Q9YBS5|RFCL_AERPE | Replication factor C large subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcL PE=3 SV=2 | 34 | 253 | 8.0E-13 |
| sp|A1RSA3|RFCL_PYRIL | Replication factor C large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcL PE=3 SV=1 | 41 | 257 | 1.0E-12 |
| sp|P06710|DPO3X_ECOLI | DNA polymerase III subunit tau OS=Escherichia coli (strain K12) GN=dnaX PE=1 SV=1 | 47 | 256 | 1.0E-12 |
| sp|Q8ZYK3|RFCL_PYRAE | Replication factor C large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcL PE=3 SV=1 | 41 | 251 | 2.0E-12 |
| sp|O13984|WRIP1_SCHPO | ATPase WRNIP1 homolog C26H5.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.02c PE=3 SV=2 | 40 | 251 | 2.0E-12 |
| sp|P74876|DPO3X_SALTY | DNA polymerase III subunit tau OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaX PE=3 SV=2 | 47 | 256 | 2.0E-12 |
| sp|P43746|DPO3X_HAEIN | DNA polymerase III subunit tau/gamma OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaX PE=3 SV=1 | 47 | 249 | 7.0E-12 |
| sp|A8AC24|RFCL_IGNH4 | Replication factor C large subunit OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rfcL PE=3 SV=1 | 41 | 252 | 7.0E-12 |
| sp|P0AAZ4|RARA_ECOLI | Replication-associated recombination protein A OS=Escherichia coli (strain K12) GN=rarA PE=1 SV=1 | 32 | 251 | 1.0E-11 |
| sp|P0AAZ5|RARA_ECOL6 | Replication-associated recombination protein A OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rarA PE=3 SV=1 | 32 | 251 | 1.0E-11 |
| sp|P0AAZ6|RARA_ECO57 | Replication-associated recombination protein A OS=Escherichia coli O157:H7 GN=rarA PE=3 SV=1 | 32 | 251 | 1.0E-11 |
| sp|B1YC69|RFCL_PYRNV | Replication factor C large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rfcL PE=3 SV=1 | 41 | 251 | 2.0E-11 |
| sp|P75177|DPO3X_MYCPN | DNA polymerase III subunit gamma/tau OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaX PE=3 SV=1 | 46 | 250 | 2.0E-11 |
| sp|F4HW65|STIL1_ARATH | Protein STICHEL-like 1 OS=Arabidopsis thaliana GN=At1g14460 PE=1 SV=1 | 46 | 246 | 3.0E-11 |
| sp|P35600|RFC1_DROME | Replication factor C subunit 1 OS=Drosophila melanogaster GN=Gnf1 PE=1 SV=2 | 42 | 250 | 3.0E-11 |
| sp|A3MS27|RFCL_PYRCJ | Replication factor C large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcL PE=3 SV=1 | 42 | 251 | 8.0E-11 |
| sp|A4WGV3|RFCL_PYRAR | Replication factor C large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcL PE=3 SV=1 | 41 | 251 | 1.0E-10 |
| sp|Q2R2B4|RFC1_ORYSJ | Replication factor C subunit 1 OS=Oryza sativa subsp. japonica GN=RFC1 PE=2 SV=2 | 19 | 251 | 1.0E-10 |
| sp|Q89A95|DPO3X_BUCBP | DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaX PE=3 SV=1 | 46 | 251 | 1.0E-10 |
| sp|P35601|RFC1_MOUSE | Replication factor C subunit 1 OS=Mus musculus GN=Rfc1 PE=1 SV=2 | 28 | 274 | 1.0E-10 |
| sp|Q8K983|DPO3X_BUCAP | DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaX PE=3 SV=1 | 47 | 270 | 1.0E-10 |
| sp|P40151|WRIP1_YEAST | DNA-dependent ATPase MGS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MGS1 PE=1 SV=2 | 12 | 257 | 1.0E-10 |
| sp|Q58817|RFCS_METJA | Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 | 43 | 91 | 2.0E-10 |
| sp|O57852|RFCS_PYRHO | Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 | 43 | 91 | 3.0E-10 |
| sp|Q58817|RFCS_METJA | Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 | 112 | 183 | 5.0E-10 |
| sp|F4KEM0|STIL4_ARATH | Protein STICHEL-like 4 OS=Arabidopsis thaliana GN=At5g45720 PE=2 SV=1 | 44 | 246 | 6.0E-10 |
| sp|Q8U4J3|RFCS_PYRFU | Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 | 43 | 91 | 9.0E-10 |
| sp|Q9V2G4|RFCS_PYRAB | Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 | 43 | 91 | 9.0E-10 |
| sp|P39918|RARA_COXBU | Replication-associated recombination protein A OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rarA PE=3 SV=3 | 40 | 251 | 9.0E-10 |
| sp|P38630|RFC1_YEAST | Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1 | 36 | 250 | 1.0E-09 |
| sp|P35251|RFC1_HUMAN | Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 | 16 | 263 | 2.0E-09 |
| sp|P57553|DPO3X_BUCAI | DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaX PE=3 SV=1 | 47 | 258 | 4.0E-09 |
| sp|Q5JHP2|RFCS_THEKO | Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 | 43 | 91 | 7.0E-09 |
| sp|P45262|RARA_HAEIN | Replication-associated recombination protein A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rarA PE=3 SV=1 | 30 | 251 | 8.0E-09 |
| sp|Q8CG07|WRIP1_RAT | ATPase WRNIP1 OS=Rattus norvegicus GN=Wrnip1 PE=1 SV=1 | 9 | 251 | 1.0E-08 |
| sp|Q18E75|RFCS_HALWD | Replication factor C small subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcS PE=3 SV=1 | 37 | 91 | 2.0E-08 |
| sp|Q54MH9|RFC1_DICDI | Probable replication factor C subunit 1 OS=Dictyostelium discoideum GN=rfc1 PE=3 SV=1 | 44 | 251 | 2.0E-08 |
| sp|F4JRP0|STIL3_ARATH | Protein STICHEL-like 3 OS=Arabidopsis thaliana GN=At4g18820 PE=3 SV=1 | 45 | 246 | 3.0E-08 |
| sp|Q91XU0|WRIP1_MOUSE | ATPase WRNIP1 OS=Mus musculus GN=Wrnip1 PE=1 SV=2 | 43 | 251 | 5.0E-08 |
| sp|Q97BC2|RFCL_THEVO | Replication factor C large subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcL PE=3 SV=1 | 42 | 264 | 1.0E-07 |
| sp|Q6L0P4|RFCL_PICTO | Replication factor C large subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcL PE=3 SV=1 | 42 | 160 | 1.0E-07 |
| sp|Q96S55|WRIP1_HUMAN | ATPase WRNIP1 OS=Homo sapiens GN=WRNIP1 PE=1 SV=2 | 43 | 251 | 1.0E-07 |
| sp|Q9C587|RFC1_ARATH | Replication factor C subunit 1 OS=Arabidopsis thaliana GN=RFC1 PE=2 SV=1 | 39 | 251 | 2.0E-07 |
| sp|Q8I615|ORC1_PLAF7 | Origin recognition complex subunit 1 OS=Plasmodium falciparum (isolate 3D7) GN=orc1 PE=2 SV=1 | 45 | 251 | 2.0E-07 |
| sp|P47658|DPO3X_MYCGE | DNA polymerase III subunit gamma/tau OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaX PE=3 SV=3 | 44 | 250 | 2.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005524 | ATP binding | Yes |
| GO:0016887 | ATP hydrolysis activity | Yes |
| GO:0000166 | nucleotide binding | No |
| GO:0043167 | ion binding | No |
| GO:0043168 | anion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0030554 | adenyl nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0005488 | binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0003674 | molecular_function | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0032559 | adenyl ribonucleotide binding | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0032555 | purine ribonucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 36 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >OphauG2|44 MSDFEDEMEVDAAPSQDISFSSEVAKGKRSAANLPVEAEDSLPWVEKYRPTTLDEVSGHQDILATINKFVDSNRL PHLLLYGPPGTGKTSTILALARRIYGASNMRQMVLELNASDDRGIDVVREQIKTFASTKQIFASARTSSTIGAFK LIILDEADAMTNTAQMALRRIMEKYTMNTRFCIIANYSHKLSPALLSRCTRFRFSPLKEADIRTLVDKVVEEEKI KIDTEAVDALVRLSKGDMRRALNVVQACHASSMPLQAKNAPRVPNDDMRGERISTETIYNCIAAPPPDAIETIMS TLLKTSDVMSCLNMMNSLKTTRGLALADIITALSEQLTKLEVSSEVMIWWLDGLAEVEHRVASGGSEVLQTGALV GVVRGGVELMGR* |
| Coding | >OphauG2|44 ATGTCCGACTTTGAGGATGAAATGGAGGTTGATGCGGCTCCATCGCAGGACATTAGCTTTTCTTCAGAAGTGGCC AAGGGCAAGCGAAGCGCGGCCAACCTGCCCGTTGAAGCCGAGGACAGTCTCCCATGGGTAGAAAAATACCGGCCG ACGACGCTTGACGAGGTATCGGGGCATCAAGACATCCTGGCCACAATTAACAAGTTTGTCGACTCGAACCGGCTG CCGCATCTGCTTCTCTACGGACCACCAGGCACGGGCAAGACGTCGACGATTCTGGCGCTGGCCCGGCGCATTTAC GGAGCTTCTAATATGCGGCAGATGGTGCTGGAACTCAATGCGTCGGACGACCGTGGCATTGACGTGGTGCGCGAA CAGATCAAGACATTTGCCAGTACCAAGCAGATATTCGCATCGGCGCGGACCAGCAGCACAATTGGTGCTTTTAAG CTTATTATCCTGGACGAGGCGGATGCCATGACCAACACAGCCCAGATGGCGCTACGGCGCATCATGGAAAAGTAT ACAATGAATACGCGCTTCTGCATCATTGCAAACTACTCACACAAGCTGAGCCCGGCCTTGCTCAGCCGGTGTACG CGGTTCCGCTTCAGTCCGCTCAAAGAGGCTGACATTCGAACGCTGGTGGACAAGGTGGTTGAAGAGGAGAAAATC AAGATTGACACGGAAGCCGTGGATGCACTAGTCAGGCTGAGCAAGGGCGACATGAGACGGGCGCTCAACGTGGTG CAAGCCTGTCATGCGTCAAGTATGCCGTTGCAAGCAAAGAATGCACCGCGAGTGCCTAATGATGATATGCGAGGG GAAAGGATATCAACAGAAACGATATACAACTGTATTGCAGCGCCGCCGCCCGACGCGATTGAAACAATCATGTCG ACGCTGCTCAAGACATCAGACGTCATGAGCTGTCTCAACATGATGAATTCGCTCAAGACTACACGTGGGCTGGCG TTGGCGGACATCATCACGGCTCTGTCGGAGCAACTGACCAAGCTTGAGGTGAGCAGCGAGGTCATGATTTGGTGG CTGGATGGACTGGCCGAGGTGGAGCACCGCGTAGCGAGCGGCGGCAGCGAGGTGTTGCAAACGGGGGCGCTTGTG GGGGTGGTAAGGGGAGGGGTGGAGCTGATGGGCAGGTAG |
| Transcript | >OphauG2|44 ATGTCCGACTTTGAGGATGAAATGGAGGTTGATGCGGCTCCATCGCAGGACATTAGCTTTTCTTCAGAAGTGGCC AAGGGCAAGCGAAGCGCGGCCAACCTGCCCGTTGAAGCCGAGGACAGTCTCCCATGGGTAGAAAAATACCGGCCG ACGACGCTTGACGAGGTATCGGGGCATCAAGACATCCTGGCCACAATTAACAAGTTTGTCGACTCGAACCGGCTG CCGCATCTGCTTCTCTACGGACCACCAGGCACGGGCAAGACGTCGACGATTCTGGCGCTGGCCCGGCGCATTTAC GGAGCTTCTAATATGCGGCAGATGGTGCTGGAACTCAATGCGTCGGACGACCGTGGCATTGACGTGGTGCGCGAA CAGATCAAGACATTTGCCAGTACCAAGCAGATATTCGCATCGGCGCGGACCAGCAGCACAATTGGTGCTTTTAAG CTTATTATCCTGGACGAGGCGGATGCCATGACCAACACAGCCCAGATGGCGCTACGGCGCATCATGGAAAAGTAT ACAATGAATACGCGCTTCTGCATCATTGCAAACTACTCACACAAGCTGAGCCCGGCCTTGCTCAGCCGGTGTACG CGGTTCCGCTTCAGTCCGCTCAAAGAGGCTGACATTCGAACGCTGGTGGACAAGGTGGTTGAAGAGGAGAAAATC AAGATTGACACGGAAGCCGTGGATGCACTAGTCAGGCTGAGCAAGGGCGACATGAGACGGGCGCTCAACGTGGTG CAAGCCTGTCATGCGTCAAGTATGCCGTTGCAAGCAAAGAATGCACCGCGAGTGCCTAATGATGATATGCGAGGG GAAAGGATATCAACAGAAACGATATACAACTGTATTGCAGCGCCGCCGCCCGACGCGATTGAAACAATCATGTCG ACGCTGCTCAAGACATCAGACGTCATGAGCTGTCTCAACATGATGAATTCGCTCAAGACTACACGTGGGCTGGCG TTGGCGGACATCATCACGGCTCTGTCGGAGCAACTGACCAAGCTTGAGGTGAGCAGCGAGGTCATGATTTGGTGG CTGGATGGACTGGCCGAGGTGGAGCACCGCGTAGCGAGCGGCGGCAGCGAGGTGTTGCAAACGGGGGCGCTTGTG GGGGTGGTAAGGGGAGGGGTGGAGCTGATGGGCAGGTAG |
| Gene | >OphauG2|44 ATGTCCGACTTTGAGGATGAAATGGAGGTTGATGCGGCTCCATCGCAGGACATTAGCTTTTCTTCAGAAGTGGCC AAGGGCAAGCGAAGCGCGGCCAACCTGCCCGTTGAAGCCGAGGACAGTCTCCCATGGTAGGCCAGAAGCACAAGA AGCACGCATTGGGGAATGTATAGCTGACGAATGGCTGATTGCAGGGTAGAAAAATACCGGCCGACGACGCTTGAC GAGGTATCGGGGCATCAAGACATCCTGGCCACAATTAACAAGTTTGTCGACTCGAACCGGCTGCCGCATCTGCTT CTCTACGGACCACCAGGCACGGGCAAGACGTCGACGATTCTGGCGCTGGCCCGGCGCATTTACGGAGCTTCTAAT ATGCGGCAGATGGTGCTGGAACTCAATGCGTCGGACGACCGTGGCATTGACGTGGTGCGCGAACAGATCAAGACA TTTGCCAGTACCAAGCAGATATTCGCATCGGCGCGGACCAGCAGCACAATTGGTGCTTTTAAGCTTATTATCCTG GACGAGGCGGATGCCATGACCAACACAGCCCAGATGGCGCTACGGCGCATCATGGAAAAGTATACAATGAATACG CGCTTCTGCATCATTGCAAACTACTCACACAAGCTGAGCCCGGCCTTGCTCAGCCGGTGTACGCGGTTCCGCTTC AGTCCGCTCAAAGAGGCTGACATTCGAACGCTGGTGGACAAGGTGGTTGAAGAGGAGAAAATCAAGATTGACACG GAAGCCGTGGATGCACTAGTCAGGCTGAGCAAGGGCGACATGAGACGGGCGCTCAACGTGGTGCAAGCCTGTCAT GCGTCAAGTAAGGGCCCTCGAGAGATTTGAGAGGTGATGGAGCGGGCTGACTGGGTGGCTGCATCAGGTATGCCG TTGCAAGCAAAGAATGCACCGCGAGTGCCTAATGATGATATGCGAGGGGAAAGGATATCAACAGAAACGATATAC AACTGTATTGCAGCGCCGCCGCCCGACGCGATTGAAACAATCATGTCGACGCTGCTCAAGACATCAGACGTCATG AGCTGTCTCAACATGATGAATTCGCTCAAGACTACACGTGGGCTGGCGTTGGCGGACATCATCACGGCTCTGTCG GAGCAACTGACCAAGCTTGAGGTGAGCAGCGAGGTCATGATTTGGTGGCTGGATGGACTGGCCGAGGTGGAGCAC CGCGTAGCGAGCGGCGGCAGCGAGGTGTTGCAAACGGGGGCGCTTGTGGGGGTGGTAAGGGGAGGGGTGGAGCTG ATGGGCAGGTAG |