Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|4385
Gene name
LocationContig_364:6017..8027
Strand+
Gene length (bp)2010
Transcript length (bp)2010
Coding sequence length (bp)2010
Protein length (aa) 670

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06732 Pescadillo_N Pescadillo N-terminus 1.7E-119 6 279
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 1.9E-04 356 429

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HCV1|PESC_CHAGB Pescadillo homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NOP7 PE=3 SV=1 1 662 0.0E+00
sp|Q7SFC2|PESC_NEUCR Pescadillo homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop7 PE=3 SV=1 1 662 0.0E+00
sp|B2WBA7|PESC_PYRTR Pescadillo homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=nop7 PE=3 SV=2 26 657 0.0E+00
sp|A1CHD1|PESC_ASPCL Pescadillo homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nop7 PE=3 SV=1 1 494 0.0E+00
sp|Q2UGQ8|PESC_ASPOR Pescadillo homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nop7 PE=3 SV=1 1 494 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HCV1|PESC_CHAGB Pescadillo homolog OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=NOP7 PE=3 SV=1 1 662 0.0E+00
sp|Q7SFC2|PESC_NEUCR Pescadillo homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop7 PE=3 SV=1 1 662 0.0E+00
sp|B2WBA7|PESC_PYRTR Pescadillo homolog OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=nop7 PE=3 SV=2 26 657 0.0E+00
sp|A1CHD1|PESC_ASPCL Pescadillo homolog OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nop7 PE=3 SV=1 1 494 0.0E+00
sp|Q2UGQ8|PESC_ASPOR Pescadillo homolog OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=nop7 PE=3 SV=1 1 494 0.0E+00
sp|Q0V577|PESC_PHANO Pescadillo homolog OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=NOP7 PE=3 SV=1 2 658 0.0E+00
sp|A6RBB0|PESC_AJECN Pescadillo homolog OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=NOP7 PE=3 SV=2 5 664 0.0E+00
sp|Q0CLP9|PESC_ASPTN Pescadillo homolog OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=nop7 PE=3 SV=1 1 664 0.0E+00
sp|A1CXF4|PESC_NEOFI Pescadillo homolog OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nop7 PE=3 SV=1 1 664 0.0E+00
sp|Q4WP65|PESC_ASPFU Pescadillo homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nop7 PE=3 SV=1 1 660 0.0E+00
sp|Q5B6K3|PESC_EMENI Pescadillo homolog OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop7 PE=3 SV=2 1 660 0.0E+00
sp|Q1DLJ4|PESC_COCIM Pescadillo homolog OS=Coccidioides immitis (strain RS) GN=NOP7 PE=3 SV=1 1 660 0.0E+00
sp|A7EGB5|PESC_SCLS1 Pescadillo homolog OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=nop7 PE=3 SV=1 1 660 0.0E+00
sp|A6SK81|PESC_BOTFB Pescadillo homolog OS=Botryotinia fuckeliana (strain B05.10) GN=nop7 PE=3 SV=1 1 660 0.0E+00
sp|A4RLI4|PESC_MAGO7 Pescadillo homolog OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NOP7 PE=3 SV=1 1 651 0.0E+00
sp|B0Y612|PESC_ASPFC Pescadillo homolog OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nop7 PE=3 SV=1 1 660 0.0E+00
sp|O60164|PESC_SCHPO Pescadillo homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppp1 PE=3 SV=1 1 662 1.0E-176
sp|A8N1X3|PESC_COPC7 Pescadillo homolog OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=NOP7 PE=3 SV=1 1 664 8.0E-149
sp|Q6FSU1|PESC_CANGA Pescadillo homolog OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP7 PE=3 SV=1 3 491 3.0E-141
sp|P53261|PESC_YEAST Pescadillo homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP7 PE=1 SV=1 3 494 1.0E-140
sp|A6ZV85|PESC_YEAS7 Pescadillo homolog OS=Saccharomyces cerevisiae (strain YJM789) GN=NOP7 PE=3 SV=1 3 494 1.0E-140
sp|Q75EI5|PESC_ASHGO Pescadillo homolog OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP7 PE=3 SV=1 3 490 2.0E-139
sp|Q6CDK0|PESC_YARLI Pescadillo homolog OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP7 PE=3 SV=1 1 491 4.0E-139
sp|A5DGY0|PESC_PICGU Pescadillo homolog OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=NOP7 PE=3 SV=2 3 490 1.0E-138
sp|Q6CQQ1|PESC_KLULA Pescadillo homolog OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP7 PE=3 SV=1 3 491 2.0E-138
sp|A7TSA8|PESC_VANPO Pescadillo homolog OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=NOP7 PE=3 SV=1 3 492 5.0E-138
sp|A9URZ4|PESC_MONBE Pescadillo homolog OS=Monosiga brevicollis GN=19511 PE=3 SV=1 1 659 8.0E-138
sp|Q59X38|PESC_CANAL Pescadillo homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP7 PE=1 SV=1 1 498 8.0E-138
sp|Q6BXL7|PESC_DEBHA Pescadillo homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP7 PE=3 SV=1 3 490 6.0E-136
sp|B0CQL7|PESC_LACBS Pescadillo homolog OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=NOP7 PE=3 SV=1 1 502 7.0E-136
sp|A8Q1F0|PESC_MALGO Pescadillo homolog OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=NOP7 PE=3 SV=1 1 662 1.0E-134
sp|A3LU56|PESC_PICST Pescadillo homolog OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=NOP7 PE=3 SV=2 1 490 7.0E-134
sp|A7SWH1|PESC_NEMVE Pescadillo homolog OS=Nematostella vectensis GN=v1g194255 PE=3 SV=1 1 520 1.0E-133
sp|A5DYS6|PESC_LODEL Pescadillo homolog OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=NOP7 PE=3 SV=1 1 491 1.0E-133
sp|O00541|PESC_HUMAN Pescadillo homolog OS=Homo sapiens GN=PES1 PE=1 SV=1 5 490 2.0E-128
sp|Q9EQ61|PESC_MOUSE Pescadillo homolog OS=Mus musculus GN=Pes1 PE=1 SV=1 5 659 2.0E-127
sp|Q7ZY69|PESC_XENLA Pescadillo homolog OS=Xenopus laevis GN=pes1 PE=2 SV=1 5 621 2.0E-125
sp|Q6DEV3|PESC_XENTR Pescadillo homolog OS=Xenopus tropicalis GN=pes1 PE=2 SV=1 5 621 2.0E-124
sp|B5X171|PESC_SALSA Pescadillo homolog OS=Salmo salar GN=pes1 PE=2 SV=1 5 490 4.0E-122
sp|B4KID9|PESC_DROMO Pescadillo homolog OS=Drosophila mojavensis GN=GI18209 PE=3 SV=1 3 666 1.0E-110
sp|B4NE56|PESC_DROWI Pescadillo homolog OS=Drosophila willistoni GN=GK25349 PE=3 SV=1 3 505 4.0E-110
sp|A8X871|PESC_CAEBR Pescadillo homolog OS=Caenorhabditis briggsae GN=lpd-7 PE=3 SV=1 3 496 3.0E-109
sp|Q0IE95|PESC_AEDAE Pescadillo homolog OS=Aedes aegypti GN=AAEL012980 PE=3 SV=1 1 664 2.0E-108
sp|B4NY70|PESC_DROYA Pescadillo homolog OS=Drosophila yakuba GN=GE10391 PE=3 SV=1 3 504 3.0E-108
sp|Q9VL96|PESC_DROME Pescadillo homolog OS=Drosophila melanogaster GN=CG4364 PE=1 SV=1 3 504 4.0E-108
sp|B3N8H0|PESC_DROER Pescadillo homolog OS=Drosophila erecta GN=GG24014 PE=3 SV=1 3 504 5.0E-108
sp|B4Q865|PESC_DROSI Pescadillo homolog OS=Drosophila simulans GN=GD22342 PE=3 SV=1 3 504 6.0E-108
sp|B4HW93|PESC_DROSE Pescadillo homolog OS=Drosophila sechellia GN=GM12330 PE=3 SV=1 3 504 7.0E-108
sp|B4LQD0|PESC_DROVI Pescadillo homolog OS=Drosophila virilis GN=GJ14807 PE=3 SV=1 3 505 2.0E-107
sp|B4JZG8|PESC_DROGR Pescadillo homolog OS=Drosophila grimshawi GN=GH25074 PE=3 SV=1 3 665 3.0E-107
sp|B0WD26|PESC_CULQU Pescadillo homolog OS=Culex quinquefasciatus GN=CPIJ004969 PE=3 SV=1 1 662 5.0E-106
sp|B3MUX9|PESC_DROAN Pescadillo homolog OS=Drosophila ananassae GN=GF21889 PE=3 SV=1 3 512 1.0E-105
sp|P0CP58|PESC_CRYNJ Pescadillo homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NOP7 PE=3 SV=1 1 480 2.0E-105
sp|P0CP59|PESC_CRYNB Pescadillo homolog OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NOP7 PE=3 SV=1 1 480 2.0E-105
sp|Q29NB4|PESC_DROPS Pescadillo homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA18135 PE=3 SV=2 3 505 3.0E-105
sp|B4G7Y6|PESC_DROPE Pescadillo homolog OS=Drosophila persimilis GN=GL19215 PE=3 SV=1 3 505 4.0E-105
sp|A8QHQ0|PESC_BRUMA Pescadillo homolog OS=Brugia malayi GN=Bm1_57380 PE=3 SV=2 9 660 3.0E-103
sp|Q7QIX1|PESC_ANOGA Pescadillo homolog OS=Anopheles gambiae GN=AGAP007112 PE=3 SV=4 1 662 2.0E-100
sp|Q95Y89|PESC_CAEEL Pescadillo homolog OS=Caenorhabditis elegans GN=lpd-7 PE=3 SV=1 3 496 2.0E-100
sp|Q54HJ2|PESC_DICDI Pescadillo homolog OS=Dictyostelium discoideum GN=DDB_G0289415 PE=3 SV=1 16 490 3.0E-87
sp|A8JBB2|PESC_CHLRE Pescadillo homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_206018 PE=3 SV=1 13 258 3.0E-68
sp|Q8IIS5|PESC_PLAF7 Pescadillo homolog OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0090 PE=3 SV=1 16 481 2.0E-51
sp|A4HS78|PESC_LEIIN Pescadillo homolog OS=Leishmania infantum GN=LINJ_04_0810 PE=3 SV=1 14 496 7.0E-51
sp|O97209|PESC_LEIMA Pescadillo homolog OS=Leishmania major GN=LmjF22.0030 PE=3 SV=1 14 480 3.0E-50
sp|Q7R7N4|PESC_PLAYO Pescadillo homolog OS=Plasmodium yoelii yoelii GN=PY07549 PE=3 SV=1 16 637 4.0E-41
sp|A4H3Z2|PESC_LEIBR Pescadillo homolog OS=Leishmania braziliensis GN=LbrM04_V2.0780 PE=3 SV=1 14 250 5.0E-40
sp|A8JBB2|PESC_CHLRE Pescadillo homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_206018 PE=3 SV=1 355 481 2.0E-17
sp|A4H3Z2|PESC_LEIBR Pescadillo homolog OS=Leishmania braziliensis GN=LbrM04_V2.0780 PE=3 SV=1 357 496 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0042254 ribosome biogenesis Yes
GO:0005730 nucleolus Yes
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0022613 ribonucleoprotein complex biogenesis No
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071840 cellular component organization or biogenesis No
GO:0008150 biological_process No
GO:0044085 cellular component biogenesis No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2177
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4385 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6095
Ophiocordyceps camponoti-floridani Ophcf2|02679
Ophiocordyceps camponoti-rufipedis Ophun1|311
Ophiocordyceps kimflemingae Ophio5|6561
Ophiocordyceps subramaniannii Hirsu2|2697

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|4385
MARVKKKGQTGAARNYITRSKAVRKLQLSLPDFRKLCIWKGIYPREPRSRKKASKSSTASTTFYYAKDIQFLLHE
PLLQRFREQKALEKKISKALGRGDVSDAKRLEGNAARPEKTGVPAFTLNHVVRERYPTFNDALRDLDDCLSMLFL
FANLPSTRSVPGKMVARCERLCLEFQHYLIATRSLTKSFLSIKGIYYQASIQGEDILWLVPYKFNQRIVGDIDFR
IMGTFVEFYMTLLGFVNFRLYTSIGLKYPPKFDVSKAENAAELGAFTLEGRALDTGEEQKLLQETAHKPDAAVQA
AVDRVVKSIQDSDEKTLSASNDTEGEVSDAIDKFEPAAQGGDILPQPAFAGGNQATLFSDCTFYLSRETPRQPLE
FLLKAFGCKRVGWDAVLGDGAYTTNELDASITHQIVDRPPIQASATEGEDKQDNQTAQKLDVNRRVPGRIYVQPQ
WVWDSVNNEELKEPHWYAPGASLPPHLSPFVKNVQGAYDPTVPLEEQEPEEEMLEASDDDGEEAEVTAQDMKTAV
SEDESQDEQEMEEESLEETQEDKAVDEDEESIKDEEEEEEDKDEEDGGAVRQLELEAELRGTSIKTKTLDGKTKA
KEEAKKALAKKARDEAEELERAKGMLSKKKRKLFEQMVYSNNKKSAEDQKLRAKRRKLDKEKNKTKAKA*
Coding >OphauG2|4385
ATGGCTCGCGTCAAGAAAAAGGGCCAGACCGGCGCGGCCAGAAACTACATTACACGCAGCAAGGCCGTCCGCAAA
CTGCAACTGAGCCTGCCCGACTTCCGCAAGCTCTGCATCTGGAAAGGCATCTATCCACGCGAGCCTCGAAGCAGG
AAAAAGGCATCTAAATCATCCACGGCGTCCACCACTTTTTACTACGCCAAGGACATTCAATTCCTCCTTCACGAG
CCATTGTTGCAACGATTTCGCGAACAAAAGGCGCTGGAAAAGAAAATTTCCAAAGCCCTGGGCCGAGGCGATGTG
TCGGATGCAAAGAGACTCGAGGGCAATGCGGCTCGGCCTGAAAAGACTGGCGTGCCGGCGTTTACTCTCAACCAT
GTCGTGCGCGAGCGCTATCCCACCTTTAACGATGCTCTTCGAGACTTGGACGATTGTTTGTCGATGCTTTTCCTC
TTTGCCAATCTGCCGTCGACTCGTAGCGTGCCGGGCAAAATGGTTGCGCGATGCGAGCGATTGTGCCTTGAATTT
CAACATTATCTCATTGCCACCAGAAGCCTGACAAAATCCTTCTTGTCCATCAAGGGCATTTATTATCAGGCCAGC
ATACAGGGCGAGGACATACTGTGGCTGGTGCCTTACAAGTTCAACCAGCGCATTGTCGGCGACATTGACTTTAGA
ATCATGGGCACGTTTGTCGAATTTTACATGACACTGCTCGGTTTCGTCAACTTTCGTCTCTACACGTCAATTGGC
CTCAAGTATCCTCCCAAGTTTGATGTCTCCAAGGCTGAAAACGCGGCCGAACTGGGTGCATTTACTCTTGAGGGC
AGGGCTCTAGATACTGGCGAGGAACAGAAACTGCTGCAAGAAACCGCCCACAAGCCTGATGCAGCAGTCCAGGCT
GCCGTCGACAGGGTTGTCAAATCGATACAAGACAGTGATGAGAAAACTTTGAGCGCATCCAACGATACAGAGGGC
GAGGTGAGCGATGCAATTGATAAGTTTGAACCTGCTGCCCAAGGCGGCGACATTTTACCGCAGCCCGCGTTTGCG
GGCGGCAATCAAGCGACCCTCTTTTCCGATTGCACATTTTACCTTTCGCGCGAGACGCCTCGGCAGCCGCTCGAA
TTTCTCCTCAAGGCATTTGGCTGCAAACGCGTGGGGTGGGATGCGGTTCTGGGCGACGGCGCTTACACAACAAAC
GAACTTGATGCCAGCATAACACATCAGATTGTCGACCGGCCCCCGATACAGGCGTCTGCGACTGAAGGGGAAGAC
AAGCAAGACAACCAAACAGCGCAGAAGCTGGATGTGAATCGCAGAGTGCCTGGCCGTATCTACGTTCAACCGCAG
TGGGTATGGGACAGCGTCAATAACGAAGAGTTGAAAGAGCCCCATTGGTATGCCCCTGGCGCGTCGCTGCCGCCT
CATCTCAGCCCCTTTGTCAAGAATGTTCAAGGAGCATATGATCCGACTGTTCCGCTTGAAGAGCAAGAGCCCGAG
GAGGAGATGCTCGAGGCGTCGGATGACGATGGCGAGGAGGCCGAGGTAACAGCTCAAGACATGAAGACGGCGGTA
TCAGAGGACGAGAGCCAGGACGAGCAAGAGATGGAAGAGGAAAGCTTGGAGGAGACACAAGAGGACAAAGCAGTG
GATGAGGATGAGGAGAGCATCAAAGATGAAGAGGAGGAGGAGGAGGATAAGGACGAGGAGGATGGCGGTGCGGTG
CGGCAATTGGAGCTAGAAGCAGAGCTCCGGGGCACGTCTATCAAGACCAAGACTTTAGATGGCAAGACCAAGGCC
AAGGAAGAGGCCAAAAAGGCACTGGCCAAGAAGGCGCGCGACGAGGCAGAGGAGCTGGAGCGGGCCAAGGGTATG
CTGAGCAAGAAGAAGCGCAAGCTGTTTGAGCAAATGGTGTACTCGAACAACAAGAAGAGCGCCGAGGACCAGAAG
CTGCGGGCGAAGCGAAGGAAGCTGGACAAGGAGAAGAACAAGACAAAGGCAAAGGCATAG
Transcript >OphauG2|4385
ATGGCTCGCGTCAAGAAAAAGGGCCAGACCGGCGCGGCCAGAAACTACATTACACGCAGCAAGGCCGTCCGCAAA
CTGCAACTGAGCCTGCCCGACTTCCGCAAGCTCTGCATCTGGAAAGGCATCTATCCACGCGAGCCTCGAAGCAGG
AAAAAGGCATCTAAATCATCCACGGCGTCCACCACTTTTTACTACGCCAAGGACATTCAATTCCTCCTTCACGAG
CCATTGTTGCAACGATTTCGCGAACAAAAGGCGCTGGAAAAGAAAATTTCCAAAGCCCTGGGCCGAGGCGATGTG
TCGGATGCAAAGAGACTCGAGGGCAATGCGGCTCGGCCTGAAAAGACTGGCGTGCCGGCGTTTACTCTCAACCAT
GTCGTGCGCGAGCGCTATCCCACCTTTAACGATGCTCTTCGAGACTTGGACGATTGTTTGTCGATGCTTTTCCTC
TTTGCCAATCTGCCGTCGACTCGTAGCGTGCCGGGCAAAATGGTTGCGCGATGCGAGCGATTGTGCCTTGAATTT
CAACATTATCTCATTGCCACCAGAAGCCTGACAAAATCCTTCTTGTCCATCAAGGGCATTTATTATCAGGCCAGC
ATACAGGGCGAGGACATACTGTGGCTGGTGCCTTACAAGTTCAACCAGCGCATTGTCGGCGACATTGACTTTAGA
ATCATGGGCACGTTTGTCGAATTTTACATGACACTGCTCGGTTTCGTCAACTTTCGTCTCTACACGTCAATTGGC
CTCAAGTATCCTCCCAAGTTTGATGTCTCCAAGGCTGAAAACGCGGCCGAACTGGGTGCATTTACTCTTGAGGGC
AGGGCTCTAGATACTGGCGAGGAACAGAAACTGCTGCAAGAAACCGCCCACAAGCCTGATGCAGCAGTCCAGGCT
GCCGTCGACAGGGTTGTCAAATCGATACAAGACAGTGATGAGAAAACTTTGAGCGCATCCAACGATACAGAGGGC
GAGGTGAGCGATGCAATTGATAAGTTTGAACCTGCTGCCCAAGGCGGCGACATTTTACCGCAGCCCGCGTTTGCG
GGCGGCAATCAAGCGACCCTCTTTTCCGATTGCACATTTTACCTTTCGCGCGAGACGCCTCGGCAGCCGCTCGAA
TTTCTCCTCAAGGCATTTGGCTGCAAACGCGTGGGGTGGGATGCGGTTCTGGGCGACGGCGCTTACACAACAAAC
GAACTTGATGCCAGCATAACACATCAGATTGTCGACCGGCCCCCGATACAGGCGTCTGCGACTGAAGGGGAAGAC
AAGCAAGACAACCAAACAGCGCAGAAGCTGGATGTGAATCGCAGAGTGCCTGGCCGTATCTACGTTCAACCGCAG
TGGGTATGGGACAGCGTCAATAACGAAGAGTTGAAAGAGCCCCATTGGTATGCCCCTGGCGCGTCGCTGCCGCCT
CATCTCAGCCCCTTTGTCAAGAATGTTCAAGGAGCATATGATCCGACTGTTCCGCTTGAAGAGCAAGAGCCCGAG
GAGGAGATGCTCGAGGCGTCGGATGACGATGGCGAGGAGGCCGAGGTAACAGCTCAAGACATGAAGACGGCGGTA
TCAGAGGACGAGAGCCAGGACGAGCAAGAGATGGAAGAGGAAAGCTTGGAGGAGACACAAGAGGACAAAGCAGTG
GATGAGGATGAGGAGAGCATCAAAGATGAAGAGGAGGAGGAGGAGGATAAGGACGAGGAGGATGGCGGTGCGGTG
CGGCAATTGGAGCTAGAAGCAGAGCTCCGGGGCACGTCTATCAAGACCAAGACTTTAGATGGCAAGACCAAGGCC
AAGGAAGAGGCCAAAAAGGCACTGGCCAAGAAGGCGCGCGACGAGGCAGAGGAGCTGGAGCGGGCCAAGGGTATG
CTGAGCAAGAAGAAGCGCAAGCTGTTTGAGCAAATGGTGTACTCGAACAACAAGAAGAGCGCCGAGGACCAGAAG
CTGCGGGCGAAGCGAAGGAAGCTGGACAAGGAGAAGAACAAGACAAAGGCAAAGGCATAG
Gene >OphauG2|4385
ATGGCTCGCGTCAAGAAAAAGGGCCAGACCGGCGCGGCCAGAAACTACATTACACGCAGCAAGGCCGTCCGCAAA
CTGCAACTGAGCCTGCCCGACTTCCGCAAGCTCTGCATCTGGAAAGGCATCTATCCACGCGAGCCTCGAAGCAGG
AAAAAGGCATCTAAATCATCCACGGCGTCCACCACTTTTTACTACGCCAAGGACATTCAATTCCTCCTTCACGAG
CCATTGTTGCAACGATTTCGCGAACAAAAGGCGCTGGAAAAGAAAATTTCCAAAGCCCTGGGCCGAGGCGATGTG
TCGGATGCAAAGAGACTCGAGGGCAATGCGGCTCGGCCTGAAAAGACTGGCGTGCCGGCGTTTACTCTCAACCAT
GTCGTGCGCGAGCGCTATCCCACCTTTAACGATGCTCTTCGAGACTTGGACGATTGTTTGTCGATGCTTTTCCTC
TTTGCCAATCTGCCGTCGACTCGTAGCGTGCCGGGCAAAATGGTTGCGCGATGCGAGCGATTGTGCCTTGAATTT
CAACATTATCTCATTGCCACCAGAAGCCTGACAAAATCCTTCTTGTCCATCAAGGGCATTTATTATCAGGCCAGC
ATACAGGGCGAGGACATACTGTGGCTGGTGCCTTACAAGTTCAACCAGCGCATTGTCGGCGACATTGACTTTAGA
ATCATGGGCACGTTTGTCGAATTTTACATGACACTGCTCGGTTTCGTCAACTTTCGTCTCTACACGTCAATTGGC
CTCAAGTATCCTCCCAAGTTTGATGTCTCCAAGGCTGAAAACGCGGCCGAACTGGGTGCATTTACTCTTGAGGGC
AGGGCTCTAGATACTGGCGAGGAACAGAAACTGCTGCAAGAAACCGCCCACAAGCCTGATGCAGCAGTCCAGGCT
GCCGTCGACAGGGTTGTCAAATCGATACAAGACAGTGATGAGAAAACTTTGAGCGCATCCAACGATACAGAGGGC
GAGGTGAGCGATGCAATTGATAAGTTTGAACCTGCTGCCCAAGGCGGCGACATTTTACCGCAGCCCGCGTTTGCG
GGCGGCAATCAAGCGACCCTCTTTTCCGATTGCACATTTTACCTTTCGCGCGAGACGCCTCGGCAGCCGCTCGAA
TTTCTCCTCAAGGCATTTGGCTGCAAACGCGTGGGGTGGGATGCGGTTCTGGGCGACGGCGCTTACACAACAAAC
GAACTTGATGCCAGCATAACACATCAGATTGTCGACCGGCCCCCGATACAGGCGTCTGCGACTGAAGGGGAAGAC
AAGCAAGACAACCAAACAGCGCAGAAGCTGGATGTGAATCGCAGAGTGCCTGGCCGTATCTACGTTCAACCGCAG
TGGGTATGGGACAGCGTCAATAACGAAGAGTTGAAAGAGCCCCATTGGTATGCCCCTGGCGCGTCGCTGCCGCCT
CATCTCAGCCCCTTTGTCAAGAATGTTCAAGGAGCATATGATCCGACTGTTCCGCTTGAAGAGCAAGAGCCCGAG
GAGGAGATGCTCGAGGCGTCGGATGACGATGGCGAGGAGGCCGAGGTAACAGCTCAAGACATGAAGACGGCGGTA
TCAGAGGACGAGAGCCAGGACGAGCAAGAGATGGAAGAGGAAAGCTTGGAGGAGACACAAGAGGACAAAGCAGTG
GATGAGGATGAGGAGAGCATCAAAGATGAAGAGGAGGAGGAGGAGGATAAGGACGAGGAGGATGGCGGTGCGGTG
CGGCAATTGGAGCTAGAAGCAGAGCTCCGGGGCACGTCTATCAAGACCAAGACTTTAGATGGCAAGACCAAGGCC
AAGGAAGAGGCCAAAAAGGCACTGGCCAAGAAGGCGCGCGACGAGGCAGAGGAGCTGGAGCGGGCCAAGGGTATG
CTGAGCAAGAAGAAGCGCAAGCTGTTTGAGCAAATGGTGTACTCGAACAACAAGAAGAGCGCCGAGGACCAGAAG
CTGCGGGCGAAGCGAAGGAAGCTGGACAAGGAGAAGAACAAGACAAAGGCAAAGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail